KEGG   Mus pahari (shrew mouse): 110319965
Entry
110319965         CDS       T05929                                 
Symbol
Vcam1
Name
(RefSeq) vascular cell adhesion protein 1 isoform X1
  KO
K06527  vascular cell adhesion molecule 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04064  NF-kappa B signaling pathway
mpah04514  Cell adhesion molecules
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110319965 (Vcam1)
   04668 TNF signaling pathway
    110319965 (Vcam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110319965 (Vcam1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110319965 (Vcam1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    110319965 (Vcam1)
   05143 African trypanosomiasis
    110319965 (Vcam1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110319965 (Vcam1)
   05418 Fluid shear stress and atherosclerosis
    110319965 (Vcam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110319965 (Vcam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110319965 (Vcam1)
   04091 Lectins [BR:mpah04091]
    110319965 (Vcam1)
CD molecules [BR:mpah04090]
 Proteins
  110319965 (Vcam1)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110319965 (Vcam1)
SSDB
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set C2-set_2 Ig_5 ICAM_N Ig_4 Ig_6 Izumo-Ig Adhes-Ig_like
Other DBs
NCBI-GeneID: 110319965
NCBI-ProteinID: XP_021051395
Ensembl: MGP_PahariEiJ_G0027008
LinkDB
Position
4:complement(104821079..104840701)
AA seq 739 aa
MPVKMVAIFGASTVLWILFAVSQAFKIEISPEYKTIAQIGDSMALTCSTTGCESPSFSWR
TQIDSPLNGKVRTEGSKSVLTMEPVSFENEHSYLCTATCGSGKLERSIHVDVYSFPKDPV
IQFSAPLEVGKPVTVKCLAPDIYPVYRLEIELFKGDHLMKRQEFFSEEMTKSLETKSLEV
TFPPAIEDIGKALVCRAKLHIDQIDSTLKERETAKELQVYISPTNTSISVHPSTKLHEGG
AVTMTCSSEGLPAPEIFWSKKLDNGVLQLLSGNATLTLIAMRMEDSGIYMCEGVNLIGRD
KTEVELVVQEKPFTVDISPGSQVAAQVGDAVVLTCAAIGCDAPSFSWRTQSDSPLNGEVR
NEGAKSTLTLSSVSFEDEHSYRCAVTCLQRTLEKRTQVEVYSFPEDPEIEMSGPLVHGRP
VTVNCTVPNVYPFDHLEIELLKGETTLMKKYFLEEMGIRSLETKSLEMTFIPTTEDTGKS
LVCLARLHSGEMESEPKQRQSVQPLYVNVAPQETTIWVSPSPTLEEGSPVNLTCSSDGFP
APKILWSRQLNNGELQPLSENTTLTFMSTKMEDSGIYVCEGINQAGVSRKSVELIIQVSP
KDIQLTVFPSKSVKEGDTVIISCTCGNVPETWIILKKKAKTGDMVLKSVDGSYTIRQAQL
QDAGIYECESKTEVGSQLRSLTLDVKGRENNKDYFSPELLALYFASSLVIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgcctgtgaagatggttgcgatctttggagcctcaacggtactttggatactgtttgca
gtctctcaagcttttaaaatcgagatctcccctgaatacaaaacgatcgctcagatcggc
gactccatggccctcacttgcagcactacaggctgcgagtcaccatcgttctcatggaga
acccagatagacagcccactaaacgggaaggtgagaacagaggggtccaagtccgttctg
accatggagcctgtcagttttgagaatgaacactcttacctgtgcacagcaacatgtggc
tctgggaagctggaaagaagtatccacgtggacgtctactctttccccaaggatccagtg
attcaattcagtgcccccctggaggttgggaagccagtcaccgtcaagtgtttggctcca
gacatttacccagtttacagactggagattgaactgttcaaaggtgaccatctcatgaaa
agacaggagtttttttcagaagagatgacaaagtctctggaaaccaaaagtttggaagta
acctttcctcccgccatcgaggatatcggaaaagctcttgtttgccgagctaaattacac
attgaccaaattgattctacgctcaaagaaagggagactgccaaagaactacaagtctac
atctctcccacgaacacatcgatctctgtacatccttccacaaagcttcatgagggtggt
gctgtgacaatgacctgttccagcgagggtctaccagctcctgagattttctggagcaag
aagttagataatggagttctccagcttctctccggaaatgctaccctcaccttaattgct
atgaggatggaagactctggaatctatatgtgtgaaggagttaatctgattgggagagac
aaaacagaggtggaattagttgttcaagagaaaccgtttaccgttgacatctcccccgga
tctcaggtggctgcacaagttggggatgcggttgttctgacatgtgctgctattggctgt
gatgccccttccttttcttggagaacccagtcagacagtcccctcaacggggaggtgagg
aatgagggggccaaatccacactgacgttgagctctgtgagttttgaggatgaacactct
taccggtgcgctgtgacctgtctgcaaaggacactggaaaagagaacccaggtggaggtc
tactcattccctgaagacccagaaattgaaatgagtgggccacttgtgcatgggagacct
gtcactgtcaactgcacggtccctaatgtgtatccctttgaccatctggagattgaatta
ctgaagggggagactacactgatgaagaaatattttttggaggaaatgggcataaggtcc
ctagagaccaaaagtttggaaatgaccttcatccccaccactgaagataccgggaaatct
cttgtttgcctcgctaggttacacagtggtgaaatggaatctgaacccaaacagaggcag
agtgtacagcctctttatgtcaacgttgccccccaggaaaccaccatctgggtcagcccc
tctcccaccctagaggagggcagtcctgtgaacctgacctgctcaagtgatggttttcca
gctcccaaaatcctgtggagcagacagctaaataacggggaactgcagcctctttctgaa
aatactaccctcaccttcatgtctacaaaaatggaagattccggcatttatgtgtgtgaa
gggattaaccaggctggagttagcagaaagtcagttgaactgattatccaagtctctcca
aaagacatacagcttacagtctttccatctaagagtgtcaaagagggagacaccgtcatt
atctcctgcacttgtggaaatgtgcccgaaacgtggataatcctgaagaagaaagcaaag
accggagacatggtattaaagtctgtggatggctcatacaccatccgccaggcacagctg
caggatgccggcatatacgagtgtgaatctaagactgaagtgggctcacaattaagaagt
ttaacacttgatgtgaaaggaagagaaaataacaaggactacttttcccccgaactcctt
gcactctactttgcatcttctttggtaatacctgccatcgggatgatcatttactttgca
agaaaagccaacatgaaaggatcgtacagtctggtggaggcacagaaatcaaaagtgtag

DBGET integrated database retrieval system