KEGG   Mus pahari (shrew mouse): 110320545
Entry
110320545         CDS       T05929                                 
Symbol
F3
Name
(RefSeq) tissue factor
  KO
K03901  coagulation factor III (tissue factor)
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110320545 (F3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110320545 (F3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110320545 (F3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110320545 (F3)
CD molecules [BR:mpah04090]
 Proteins
  110320545 (F3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Others
  110320545 (F3)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac PRIMA1
Other DBs
NCBI-GeneID: 110320545
NCBI-ProteinID: XP_021052277
Ensembl: MGP_PahariEiJ_G0027034
LinkDB
Position
4:110184026..110195717
AA seq 294 aa
MAILVSPRLLAALAPAFLGCLLLQVTTGAGIPEKAFNLTWISTDFKTILEWQPKPTNYTY
TVQISDRSRNWKYKCISTTDTECDLTDEVVKDVHWTYEAKVLSVPRRNSVYGDEDQLVIH
GQEPPFTNAPKFLPYRDTLLGQPVIQQFEQDSRKLNVLVKDTLTLVRKNGTFLTMRQVFG
KDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGTSYCFFVQAMIFSRKNNQKSPESITV
CTEQWKSIMGETLIIVGAVVFLATVFIILLSISLCKRRNRRAGQKRKNTPSGLA
NT seq 885 nt   +upstreamnt  +downstreamnt
atggcgatcctcgtgagcccgcgcctcctagcggctctcgcgcccgcctttctcggctgc
ctcctcctccaggtgaccacgggtgcaggcattccagagaaagcttttaatttaacttgg
atatcaactgatttcaagacaattttggagtggcaacccaaacccaccaactatacctac
actgttcagataagcgatcgatctagaaactggaaatacaagtgcatctcaaccacagac
accgagtgtgacctcacagacgaggtggtgaaggatgtgcactggacctatgaagcaaag
gtactatctgtcccacggaggaactcagtttatggagacgaagaccagcttgtgattcat
gggcaggagccgccatttacaaacgcccccaagtttttaccttaccgagacacattactc
ggacagccagtaattcagcagtttgaacaagatagtagaaaactgaatgtgcttgtaaaa
gacacacttacattagtcagaaagaatggcacgttcctcaccatgcggcaagtctttggc
aaggacttgggttatataataacttatcggaaaggctcgagcaccggaaagaaaacaaac
attacaaataccaatgaattctcgattgatgtggaagaaggaacaagctactgctttttt
gtacaagctatgatcttctccaggaaaaacaaccaaaagagcccagaaagcattacagtg
tgcactgagcaatggaagagtatcatgggagaaacactcatcattgtgggagcagtggtg
ttcctggccaccgtctttatcatcctcttgtccatatctctgtgcaagcgcagaaataga
cgagcgggacagaaaaggaagaacaccccatcaggcttggcatag

DBGET integrated database retrieval system