KEGG   Mus pahari (shrew mouse): 110320578
Entry
110320578         CDS       T05929                                 
Symbol
Cd2
Name
(RefSeq) T-cell surface antigen CD2
  KO
K06449  T-cell surface glycoprotein CD2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110320578 (Cd2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110320578 (Cd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320578 (Cd2)
   04090 CD molecules [BR:mpah04090]
    110320578 (Cd2)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110320578 (Cd2)
CD molecules [BR:mpah04090]
 Proteins
  110320578 (Cd2)
SSDB
Motif
Pfam: C2-set TMEM171 Ig_2 LapA_dom EphA2_TM
Other DBs
NCBI-GeneID: 110320578
NCBI-ProteinID: XP_021052314
Ensembl: MGP_PahariEiJ_G0026874
LinkDB
Position
4:complement(91078543..91090112)
AA seq 343 aa
MKCEFLGFFLLFSLSGKGVDCRDNGIIWGVLGHGITLNIPDFQMTDDIDEVRWVRRDTLV
AEFKRKGAAFLISEMYEVLENGSLKIKKPMMRNDSDTYNVMAYGTNGMVRLSKALDLRIL
EMVSKPVIHWECPSTTLTCAILQGTDFELKLYQGGKHLKSLPQKNMSYQWTNLRAPFKCE
AINGVSKESKTEVVNCPEKRLTLYITVGAGAGGLLLVLFGTVFIFCICKRKKRNRRRKDE
ELEIKASRTSTVERGPKPHSTPAAAVQNPVALQAPPPPGPHLQTPGHRPLPPSHRTREHQ
QKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGEGVSLPPPN
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaatgtgaattcttgggtttctttctgctcttcagcctttcaggcaaaggggtggac
tgcagagacaatgggatcatctggggtgtcttgggtcacggcatcaccctgaacattcct
gactttcaaatgactgatgatattgatgaggtgcgatgggtaaggagggacaccctggtt
gcagagtttaaaaggaagggggcagcttttttgatatcagaaatgtatgaggtcttagaa
aacggatccttgaagataaagaagccgatgatgagaaatgacagcgacacctacaatgta
atggcgtatggcacaaatgggatggttaggctgtcgaaggcgctggacttgaggattctg
gagatggtctcaaagcccgtgatccactgggagtgccccagcacaaccctgacctgtgcg
atcttacaagggacagattttgaactaaagctgtatcaagggggaaaacacctcaagagc
ctcccccagaagaacatgagttaccagtggaccaacctgagagcaccattcaagtgtgag
gcgataaatggggtcagcaaggagtctaagacggaagtggtcaactgtccagagaaacgt
ctgaccctctatatcacagtgggggccggtgcaggaggactcctcttggtgctctttggg
acagtgtttattttctgtatctgcaagaggaaaaaacggaacaggaggagaaaagatgaa
gagctggagataaaagcttccagaacaagcactgtggaaaggggccccaagccgcattca
accccagctgcagcagtgcagaatccagtggcgctccaagctcctcctccacctggccct
cacctccagacacctggccatcgtcccttgcctccgagccaccgtacccgtgagcaccag
cagaagaagagacctcctccatcaggcacacagattcaccagcagaaaggccctccttta
cccagaccccgagttcagccaaagcctccctgtgggagtggagaaggtgtttcactgccg
ccccctaattaa

DBGET integrated database retrieval system