Mus pahari (shrew mouse): 110320595 Help Entry 110320595         CDS       T05929                                  Symbol S100a10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04382   Cornified envelope formation mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     110320595 (S100a10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110320595 (S100a10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110320595 (S100a10) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of microglial cells    110320595 (S100a10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  110320595 NCBI-ProteinID:  XP_021052341 Ensembl:  MGP_PahariEiJ_G0026747 LinkDB All DBs Position 4:83860453..83869912 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLKVLMEREFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatcccaaatggagcacgccatggaaaccatgatgcttacgtttcacaggtttgca ggcgacaaagaccacttgacaaaggaggacctgaaagtgctcatggaacgggagttccct gggtttttggaaaatcaaaaggaccctctggctgtggacaaaataatgaaggacctggac cagtgccgagatggcagagtgggcttccagagctttctctcactagtggcggggctcacc atcgcatgcaatgactattttgtagtaaacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system