KEGG   Mus pahari (shrew mouse): 110321008
Entry
110321008         CDS       T05929                                 

Gene name
Ppp3ca
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04720  Long-term potentiation
mpah04724  Glutamatergic synapse
mpah04728  Dopaminergic synapse
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110321008 (Ppp3ca)
   04310 Wnt signaling pathway
    110321008 (Ppp3ca)
   04370 VEGF signaling pathway
    110321008 (Ppp3ca)
   04020 Calcium signaling pathway
    110321008 (Ppp3ca)
   04022 cGMP-PKG signaling pathway
    110321008 (Ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110321008 (Ppp3ca)
   04218 Cellular senescence
    110321008 (Ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110321008 (Ppp3ca)
   04650 Natural killer cell mediated cytotoxicity
    110321008 (Ppp3ca)
   04660 T cell receptor signaling pathway
    110321008 (Ppp3ca)
   04658 Th1 and Th2 cell differentiation
    110321008 (Ppp3ca)
   04659 Th17 cell differentiation
    110321008 (Ppp3ca)
   04662 B cell receptor signaling pathway
    110321008 (Ppp3ca)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110321008 (Ppp3ca)
   04921 Oxytocin signaling pathway
    110321008 (Ppp3ca)
   04924 Renin secretion
    110321008 (Ppp3ca)
  09156 Nervous system
   04724 Glutamatergic synapse
    110321008 (Ppp3ca)
   04728 Dopaminergic synapse
    110321008 (Ppp3ca)
   04720 Long-term potentiation
    110321008 (Ppp3ca)
  09158 Development and regeneration
   04360 Axon guidance
    110321008 (Ppp3ca)
   04380 Osteoclast differentiation
    110321008 (Ppp3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110321008 (Ppp3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110321008 (Ppp3ca)
   05170 Human immunodeficiency virus 1 infection
    110321008 (Ppp3ca)
   05163 Human cytomegalovirus infection
    110321008 (Ppp3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110321008 (Ppp3ca)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110321008 (Ppp3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110321008 (Ppp3ca)
   05014 Amyotrophic lateral sclerosis
    110321008 (Ppp3ca)
   05020 Prion disease
    110321008 (Ppp3ca)
   05022 Pathways of neurodegeneration - multiple diseases
    110321008 (Ppp3ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    110321008 (Ppp3ca)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110321008 (Ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110321008 (Ppp3ca)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110321008 (Ppp3ca)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     110321008 (Ppp3ca)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 110321008
NCBI-ProteinID: XP_021052748
Ensembl: MGP_PahariEiJ_G0027113
LinkDB
Position
4
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcgattgatcccaagttgtcgacgaccgacagggtggtgaaagcc
gttccatttccgccaagtcaccggctgacagcaaaagaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaagcacatctcatgaaggagggcaggctggaagaaagtgtt
gcattgagaataataacagagggtgcttcgattctccgacaggaaaaaaacttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctctttgaagtgggaggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagggggtacttcagtatcgagtgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgcggaaaccatgaatgtaggcacctcacagagtatttc
acgtttaaacaagaatgtaaaataaagtattcagaacgcgtttatgatgcctgtatggat
gccttcgactgccttcccctggccgcgctgatgaaccagcagttcctgtgtgtacacggt
ggtttgtctccagagattaacactctagatgacatcagaaaattagaccgattcaaagaa
ccacctgcttatggacccatgtgtgacatcctgtggtcagaccccctggaggactttgga
aatgagaagactcaggaacatttcactcacaacacagtcaggggctgttcgtacttctac
agttacccggctgtgtgtgacttcctgcagcacaataatttgttgtccatactccgtgcc
cacgaagcccaggatgcagggtaccgcatgtacaggaaaagccaaacaaccggcttcccg
tctctaatcaccatcttctcagcaccaaactacttagatgtgtacaacaacaaagctgca
gtgttgaagtacgagaacaatgtgatgaacatcaggcagttcaactgctccccgcatccg
tactggctcccaaacttcatggatgtcttcacctggtcgctgccgtttgttggggagaaa
gtgaccgagatgctggtcaatgttctcaacatctgctccgatgacgaactgggctcagaa
gaagatggatttgacggagccacggccgcagcccggaaggaagtcatcaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagttctcagagaagagagtgagagtgtt
ctgacactgaagggcctgaccccaactggcatgctccccagcggggtactctctggtggc
aaacagactctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaaaggcttagaccgaattaac
gagaggatgccgcctcgccgagatgccatgccctccgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Mus pahari (shrew mouse): 110322987
Entry
110322987         CDS       T05929                                 

Gene name
Ppp3r2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04720  Long-term potentiation
mpah04724  Glutamatergic synapse
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110322987 (Ppp3r2)
   04310 Wnt signaling pathway
    110322987 (Ppp3r2)
   04370 VEGF signaling pathway
    110322987 (Ppp3r2)
   04020 Calcium signaling pathway
    110322987 (Ppp3r2)
   04022 cGMP-PKG signaling pathway
    110322987 (Ppp3r2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110322987 (Ppp3r2)
   04218 Cellular senescence
    110322987 (Ppp3r2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110322987 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    110322987 (Ppp3r2)
   04660 T cell receptor signaling pathway
    110322987 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    110322987 (Ppp3r2)
   04659 Th17 cell differentiation
    110322987 (Ppp3r2)
   04662 B cell receptor signaling pathway
    110322987 (Ppp3r2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110322987 (Ppp3r2)
   04921 Oxytocin signaling pathway
    110322987 (Ppp3r2)
   04924 Renin secretion
    110322987 (Ppp3r2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110322987 (Ppp3r2)
   04720 Long-term potentiation
    110322987 (Ppp3r2)
  09158 Development and regeneration
   04360 Axon guidance
    110322987 (Ppp3r2)
   04380 Osteoclast differentiation
    110322987 (Ppp3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110322987 (Ppp3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322987 (Ppp3r2)
   05170 Human immunodeficiency virus 1 infection
    110322987 (Ppp3r2)
   05163 Human cytomegalovirus infection
    110322987 (Ppp3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322987 (Ppp3r2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110322987 (Ppp3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110322987 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis
    110322987 (Ppp3r2)
   05020 Prion disease
    110322987 (Ppp3r2)
   05022 Pathways of neurodegeneration - multiple diseases
    110322987 (Ppp3r2)
  09165 Substance dependence
   05031 Amphetamine addiction
    110322987 (Ppp3r2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110322987 (Ppp3r2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110322987 (Ppp3r2)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     110322987 (Ppp3r2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 Toprim_3
Other DBs
NCBI-GeneID: 110322987
NCBI-ProteinID: XP_021055652
Ensembl: MGP_PahariEiJ_G0028353
LinkDB
Position
6
AA seq 179 aa
MGNESSYQAELCNHFDQEEIKRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVID
IFDTDGNGEVDFHEFIMGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKAMEIHKKLVVFVEHGQEDVNA
NT seq 540 nt   +upstreamnt  +downstreamnt
atgggaaatgagtccagctaccaagctgagctgtgcaaccacttcgaccaggaagagatc
aaaaggctaggtaaaagcttcaggaagctggacttggacaaatcgggctccctgagcata
gaagagttcatgaggctgcctgagctgcagcagaatccgctggtgggccgagtgatcgac
atcttcgacacagacggcaatggggaagtggacttccatgaattcatcatgggcacctcc
cagttcagcgtcaagggtgacgaagagcagaagctgaggttcgccttcagaatctacgac
atggataatgatggtttcatctccaacggggagctcttccaagtgcttaagatgatggtg
ggaaacaacctcaaggactggcagctgcagcagctggtggacaagagcatcttggtcctg
gataaggatggcgatggccggatatcctttgaagagttcagtgatgtggtcaaagccatg
gagatccacaagaaattggtcgtgtttgtagaacacggtcaagaagacgtaaacgcttaa

KEGG   Mus pahari (shrew mouse): 110325335
Entry
110325335         CDS       T05929                                 

Gene name
Ppp3cb
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04720  Long-term potentiation
mpah04724  Glutamatergic synapse
mpah04728  Dopaminergic synapse
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110325335 (Ppp3cb)
   04310 Wnt signaling pathway
    110325335 (Ppp3cb)
   04370 VEGF signaling pathway
    110325335 (Ppp3cb)
   04020 Calcium signaling pathway
    110325335 (Ppp3cb)
   04022 cGMP-PKG signaling pathway
    110325335 (Ppp3cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110325335 (Ppp3cb)
   04218 Cellular senescence
    110325335 (Ppp3cb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110325335 (Ppp3cb)
   04650 Natural killer cell mediated cytotoxicity
    110325335 (Ppp3cb)
   04660 T cell receptor signaling pathway
    110325335 (Ppp3cb)
   04658 Th1 and Th2 cell differentiation
    110325335 (Ppp3cb)
   04659 Th17 cell differentiation
    110325335 (Ppp3cb)
   04662 B cell receptor signaling pathway
    110325335 (Ppp3cb)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110325335 (Ppp3cb)
   04921 Oxytocin signaling pathway
    110325335 (Ppp3cb)
   04924 Renin secretion
    110325335 (Ppp3cb)
  09156 Nervous system
   04724 Glutamatergic synapse
    110325335 (Ppp3cb)
   04728 Dopaminergic synapse
    110325335 (Ppp3cb)
   04720 Long-term potentiation
    110325335 (Ppp3cb)
  09158 Development and regeneration
   04360 Axon guidance
    110325335 (Ppp3cb)
   04380 Osteoclast differentiation
    110325335 (Ppp3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110325335 (Ppp3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110325335 (Ppp3cb)
   05170 Human immunodeficiency virus 1 infection
    110325335 (Ppp3cb)
   05163 Human cytomegalovirus infection
    110325335 (Ppp3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110325335 (Ppp3cb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110325335 (Ppp3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325335 (Ppp3cb)
   05014 Amyotrophic lateral sclerosis
    110325335 (Ppp3cb)
   05020 Prion disease
    110325335 (Ppp3cb)
   05022 Pathways of neurodegeneration - multiple diseases
    110325335 (Ppp3cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    110325335 (Ppp3cb)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110325335 (Ppp3cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110325335 (Ppp3cb)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110325335 (Ppp3cb)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     110325335 (Ppp3cb)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 110325335
NCBI-ProteinID: XP_021058929
Ensembl: MGP_PahariEiJ_G0030005
LinkDB
Position
8
AA seq 478 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSP
HPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIR
NKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKA
IRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTENHGTGNHSAQ
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcactaagaattatcaatgagggtgctgccatacttcggcgggagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcttg
aagattctatacccaagcacattattccttctgagaggcaaccatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaaatattctgaaagagtatatgaa
gcttgtatggaggcttttgacagcttgccccttgctgcacttctaaaccaacaatttctt
tgtgttcatggtggactttcaccagaaatacacacactggatgatattaggagattagat
agatttaaagagccacctgcatttggaccaatgtgtgacttgctatggtctgatccttct
gaagactttggaaatgaaaaatcacaagaacattttagtcataatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggaatgtacagaaaaagtcaaactacaggg
tttccttcattaataacaattttttcggcacctaattacttagatgtctacaataataaa
gctgctgtactaaagtatgaaaataatgtgatgaacattcgacagtttaattgctctcca
catccttattggttgcccaattttatggatgtctttacatggtcattaccatttgttgga
gaaaaagtgacagaaatgttggtaaatgttctgagtatttgttctgatgatgaactaatg
acagaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatcataaga
aacaagatccgagcaattggcaagatggcaagagtcttctctgttctcagggaggagagt
gaaagcgtgctgacactcaagggcctgactcccacagggatgttgcctagtggagtgttg
gctggaggacggcagaccttgcaaagtgccacagttgaggctattgaggctgaaaaagca
atacgaggattctccccaccacatagaatctgcagttttgaagaggcaaagggtttggat
aggatcaatgagagaatgccaccccggaaagatgctgtgcagcaagatggtttcaattcc
ctgaacaccgcacataccactgagaaccacgggactggcaaccatagtgcccagtga

KEGG   Mus pahari (shrew mouse): 110325367
Entry
110325367         CDS       T05929                                 

Gene name
Ppp3cc
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04720  Long-term potentiation
mpah04724  Glutamatergic synapse
mpah04728  Dopaminergic synapse
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110325367 (Ppp3cc)
   04310 Wnt signaling pathway
    110325367 (Ppp3cc)
   04370 VEGF signaling pathway
    110325367 (Ppp3cc)
   04020 Calcium signaling pathway
    110325367 (Ppp3cc)
   04022 cGMP-PKG signaling pathway
    110325367 (Ppp3cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110325367 (Ppp3cc)
   04218 Cellular senescence
    110325367 (Ppp3cc)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110325367 (Ppp3cc)
   04650 Natural killer cell mediated cytotoxicity
    110325367 (Ppp3cc)
   04660 T cell receptor signaling pathway
    110325367 (Ppp3cc)
   04658 Th1 and Th2 cell differentiation
    110325367 (Ppp3cc)
   04659 Th17 cell differentiation
    110325367 (Ppp3cc)
   04662 B cell receptor signaling pathway
    110325367 (Ppp3cc)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110325367 (Ppp3cc)
   04921 Oxytocin signaling pathway
    110325367 (Ppp3cc)
   04924 Renin secretion
    110325367 (Ppp3cc)
  09156 Nervous system
   04724 Glutamatergic synapse
    110325367 (Ppp3cc)
   04728 Dopaminergic synapse
    110325367 (Ppp3cc)
   04720 Long-term potentiation
    110325367 (Ppp3cc)
  09158 Development and regeneration
   04360 Axon guidance
    110325367 (Ppp3cc)
   04380 Osteoclast differentiation
    110325367 (Ppp3cc)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110325367 (Ppp3cc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110325367 (Ppp3cc)
   05170 Human immunodeficiency virus 1 infection
    110325367 (Ppp3cc)
   05163 Human cytomegalovirus infection
    110325367 (Ppp3cc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110325367 (Ppp3cc)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110325367 (Ppp3cc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110325367 (Ppp3cc)
   05014 Amyotrophic lateral sclerosis
    110325367 (Ppp3cc)
   05020 Prion disease
    110325367 (Ppp3cc)
   05022 Pathways of neurodegeneration - multiple diseases
    110325367 (Ppp3cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    110325367 (Ppp3cc)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110325367 (Ppp3cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110325367 (Ppp3cc)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110325367 (Ppp3cc)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     110325367 (Ppp3cc)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 110325367
NCBI-ProteinID: XP_021058983
Ensembl: MGP_PahariEiJ_G0030495
LinkDB
Position
8
AA seq 522 aa
MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNHLVKEGRVEEEVALKI
INDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEVVYDACMHTFDC
LPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFTEPPAFGPVCDLLWSDPLEDYGSEKT
LEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDEEMNFADEEDHYISSCPKGATTGRKEVIKNKIRAIGKMARVFTVLREESE
NVLTLKGLTPTGTLPLGVLSGGKQTIETAKEQAAEEREAIRSFTIAHRIRSFEEARGLDR
INERMPPRKEASFHHDAGRMHSHPHPPHMQASRRTDHGKKAL
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtccgtgaggcgccctcagttctccacgaccgagcgcgtcatcaaagctgtccccttt
cctccaacccgacggctaactttgaaggaagtatttgagaatgggaaacctaaaatggat
cttttgaaaaaccatttagtaaaagaaggccgggtggaagaggaagtggccttaaagatc
attaatgatggggctgccatcctgaagcaggagaagaccatgatagaggtggaggctccg
attacagtgtgtggtgatgttcatggacagttctttgacctgatgaagctgtttgaagtc
gggggatcacctagtaacactcgctacctcttcctgggcgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatctatggagcttaaagattaaccatcctaaaacattg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagagtacttcaccttcaaacag
gaatgtcggatcaagtattcagaggtggtgtacgatgcgtgcatgcacactttcgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtctcct
gaaattacttgtttagaggacattaggaaattagataggtttactgaacctcctgctttt
gggccagtgtgtgacctgctttggtctgaccccttggaggactatggcagtgagaagacc
ctggagcactacacccacaacactgtccgaggctgctcctacttcttcagttaccctgca
gtttgtgaatttttacagaacaacagtttattatcaataatcagagcccacgaagcccag
gatgcggggtaccggatgtataggaagaaccaagcaaccggctttccgtcacttattacg
attttctctgcccctaattacctagatgtctataacaataaagctgcagtgttgaaatat
gaaaacaatgtcatgaacatcaggcagttcaactgttctccacacccctactggctccca
aacttcatggatgttttcacgtggtctttgccttttgttggagagaaagtgacagagatg
ctggtcaatattctcaacatatgctcggatgaagaaatgaacttcgccgatgaagaagat
cactacatttcaagctgtccaaaaggagccactacaggtcgaaaagaagtcatcaagaat
aaaatccgagccattgggaaaatggcccgggtctttacggttcttcgggaagagagtgag
aatgtgctgaccctcaagggcctcactcccacaggcacactcccactgggggtcctctct
ggaggaaagcagaccattgagactgccaaagaacaagccgcagaggagcgggaagccatc
agaagtttcacaattgcacacaggatccgaagttttgaagaagcccgaggtctggaccga
attaatgagagaatgccaccccgaaaagaggcttcgtttcatcatgatgcagggaggatg
cactcgcacccgcatccgccacacatgcaggcgtcaagaaggaccgaccatggaaagaaa
gccctgtaa

KEGG   Mus pahari (shrew mouse): 110330477
Entry
110330477         CDS       T05929                                 

Gene name
Ppp3r1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04114  Oocyte meiosis
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04720  Long-term potentiation
mpah04724  Glutamatergic synapse
mpah04921  Oxytocin signaling pathway
mpah04922  Glucagon signaling pathway
mpah04924  Renin secretion
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05152  Tuberculosis
mpah05163  Human cytomegalovirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110330477 (Ppp3r1)
   04310 Wnt signaling pathway
    110330477 (Ppp3r1)
   04370 VEGF signaling pathway
    110330477 (Ppp3r1)
   04020 Calcium signaling pathway
    110330477 (Ppp3r1)
   04022 cGMP-PKG signaling pathway
    110330477 (Ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110330477 (Ppp3r1)
   04218 Cellular senescence
    110330477 (Ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110330477 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    110330477 (Ppp3r1)
   04660 T cell receptor signaling pathway
    110330477 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    110330477 (Ppp3r1)
   04659 Th17 cell differentiation
    110330477 (Ppp3r1)
   04662 B cell receptor signaling pathway
    110330477 (Ppp3r1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110330477 (Ppp3r1)
   04921 Oxytocin signaling pathway
    110330477 (Ppp3r1)
   04924 Renin secretion
    110330477 (Ppp3r1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110330477 (Ppp3r1)
   04720 Long-term potentiation
    110330477 (Ppp3r1)
  09158 Development and regeneration
   04360 Axon guidance
    110330477 (Ppp3r1)
   04380 Osteoclast differentiation
    110330477 (Ppp3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110330477 (Ppp3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110330477 (Ppp3r1)
   05170 Human immunodeficiency virus 1 infection
    110330477 (Ppp3r1)
   05163 Human cytomegalovirus infection
    110330477 (Ppp3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110330477 (Ppp3r1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110330477 (Ppp3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110330477 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis
    110330477 (Ppp3r1)
   05020 Prion disease
    110330477 (Ppp3r1)
   05022 Pathways of neurodegeneration - multiple diseases
    110330477 (Ppp3r1)
  09165 Substance dependence
   05031 Amphetamine addiction
    110330477 (Ppp3r1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110330477 (Ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110330477 (Ppp3r1)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     110330477 (Ppp3r1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 110330477
NCBI-ProteinID: XP_021066261
Ensembl: MGP_PahariEiJ_G0016784
LinkDB
Position
13
AA seq 212 aa
MNFQSQFFFPTGKNFEKKDKDHFRQNKYPFSRELYNLIFSERKGNEASYPLEMCSHFDAD
EIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEG
VSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTII
NADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactttcagtcacagtttttcttccctacaggaaagaattttgagaaaaaagacaaa
gaccacttccggcaaaataagtacccattctcaagggaactttataacctgatttttagt
gaaagaaagggaaatgaggcaagttaccctttggaaatgtgctcacactttgatgctgat
gagattaaaaggctaggaaagagattcaagaagctggatttggacaattctggctctttg
agcgtggaagagttcatgtctctgcctgagttgcagcagaacccgttagtacagcgggta
atagatatattcgacaccgatgggaatggagaagtagacttcaaagaattcattgaagga
gtctctcagttcagtgtcaaaggcgataaggaacagaagttgaggtttgcttttcgtatc
tatgacatggataaagatggctatatttccaatggagaactcttccaggtgttgaagatg
atggtgggcaacaatctgaaagatacacaattacagcagattgtagacaaaaccataata
aatgcagataaggatggagatggaagaatatcctttgaggaattctgtgctgttgtaggt
ggcctagatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system