Mus pahari (shrew mouse): 110321041 Help Entry 110321041         CDS       T05929                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05203   Viral carcinogenesis mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110321041  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110321041   09163 Immune disease    05322 Systemic lupus erythematosus     110321041   09165 Substance dependence    05034 Alcoholism     110321041  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110321041 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110321041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  110321041 NCBI-ProteinID:  XP_021052794 Ensembl:  MGP_PahariEiJ_G0026817 LinkDB All DBs Position 4:complement(86460202..86460715) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgaggaaagggcggaaagggcctaggtaaaggcggtgccaagcgccaccgc aaggtcctgcgggacaacatccagggcatcaccaagcctgccatccgccgcctggctcgg cgcggtggtgtcaagcgcatctctggtctcatctacgaggagacccgtggtgtgctgaag gtgttcctggagaacgtcatccgcgacgcagtcacctacactgagcacgccaagcgcaag accgtcaccgccatggatgtggtgtacgctctcaagcgccagggccgcaccctctacggc ttcggaggctag

DBGET integrated database retrieval system