Mus pahari (shrew mouse): 110321138 Help Entry 110321138         CDS       T05929                                  Symbol Prlh Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism mpah  Mus pahari (shrew mouse) Pathway mpah04080   Neuroactive ligand-receptor interaction mpah04081   Hormone signaling Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     110321138 (Prlh)    04081 Hormone signaling     110321138 (Prlh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110321138 (Prlh) Cytokines and neuropeptides [BR:mpah04052]  Neuropeptides   GPCR binding    110321138 (Prlh) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP LEAP-2 Motif Other DBs NCBI-GeneID:  110321138 NCBI-ProteinID:  XP_021052873 Ensembl:  MGP_PahariEiJ_G0027648 LinkDB All DBs Position 5:68314753..68315702 Genome browser AA seq 86 aa AA seqDB search MTLRTWLLCLLLLGLVLPGASSRAHQHSMETRTPDINPAWYTGRGIRPVGRFGRRRAALR DVTGPGLRYRLSCLPLDGSAKFSQRG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacactgaggacctggcttctgtgcttgctgctgctcggcttagtcctcccaggagct tccagccgagcccaccagcactccatggagacccgcacccctgacatcaatcctgcctgg tacacgggccgtgggatcaggcctgtgggccgcttcgggaggaggagggcagccctgagg gatgtcaccggacctggcctgcggtaccgactaagctgcctcccactggatggaagtgcc aagttctctcagcgtggataa

DBGET integrated database retrieval system