KEGG   Mus pahari (shrew mouse): 110321139
Entry
110321139         CDS       T05929                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04062  Chemokine signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05212  Pancreatic cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110321139 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110321139 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110321139 (Stat1)
   04621 NOD-like receptor signaling pathway
    110321139 (Stat1)
   04625 C-type lectin receptor signaling pathway
    110321139 (Stat1)
   04658 Th1 and Th2 cell differentiation
    110321139 (Stat1)
   04659 Th17 cell differentiation
    110321139 (Stat1)
   04062 Chemokine signaling pathway
    110321139 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110321139 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    110321139 (Stat1)
   04919 Thyroid hormone signaling pathway
    110321139 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110321139 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321139 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110321139 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110321139 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110321139 (Stat1)
   05160 Hepatitis C
    110321139 (Stat1)
   05171 Coronavirus disease - COVID-19
    110321139 (Stat1)
   05164 Influenza A
    110321139 (Stat1)
   05162 Measles
    110321139 (Stat1)
   05168 Herpes simplex virus 1 infection
    110321139 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110321139 (Stat1)
   05169 Epstein-Barr virus infection
    110321139 (Stat1)
   05165 Human papillomavirus infection
    110321139 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110321139 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110321139 (Stat1)
   05140 Leishmaniasis
    110321139 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110321139 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110321139 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110321139 (Stat1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110321139 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 BLI1 TRPM_tetra
Other DBs
NCBI-GeneID: 110321139
NCBI-ProteinID: XP_021052874
Ensembl: MGP_PahariEiJ_G0027360
LinkDB
Position
5
AA seq 749 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIHNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEHEIKTLEDLQDEYDFKCKTSQNR
ESETNGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAESLQQVRQQLKKLEELEQKFTYEPDPITKNKQV
LSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKDRERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEMSRIVGSEFDSMMSTV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcacagtggtacgagcttcagcagctggactccaagttcctggagcaggtccaccag
ctgtacgatgacagtttccccatggaaatcagacagtacctggcccagtggctggaaaag
caagactgggagcacgccgcctatgatgtctcatttgccaccatccgcttccacgacctc
ctctcgcagctggacgaccagtacagccgcttttctctggagaataatttcttgttgcag
cacaacataaggaaaagcaagcgtaacctccaggataacttccaagaagatcccgtacag
atgtccatgatcatccacaactgtctgaaggaagaaaggaagattttggaaaatgcccaa
agatttaaccaggcccaggagggaaatattcagaacactgtgatgttagataaacagaag
gagctggacagtaaagtcagaaatgtgaaggatcaggtcatgtgcatagaacatgaaatc
aagaccctagaagatttacaagatgaatatgactttaaatgcaaaacatcacagaacaga
gaaagtgaaaccaatggtgtggcgaagagcgaccagaaacaggaacagctgctgctccat
aagatgtttttaatgcttgacaataagagaaaggagataattcacaagatcagagagttg
ctgaattccatcgagctcactcagaacactctgattaatgacgagctcgtggagtggaag
cgaaggcagcagagcgcctgcattgggggaccgcccaacgcctgcctggatcagctgcaa
agctggttcaccattgttgcagagagcctgcagcaggtccgtcagcagcttaaaaagctg
gaggagttggaacagaaattcacctatgagcccgacccgattacaaaaaacaagcaggtg
ttgtcagatcgcaccttcctcctcttccagcagctcattcagagctccttcgtggtagaa
cgacagccatgcatgccgactcacccgcagaggcccctggtcttgaagactggggtacag
ttcactgtcaagctgaggctgttggtgaagttgcaagagctgaactataacttgaaagtg
aaagtctcatttgacaaagatgtgaacgagaaaaacacagtgaaagggtttcggaagttc
aacatcttgggtacgcacacaaaagtgatgaacatggaagaatccaccaacggaagtctg
gcggctgagttccgacacctgcaactgaaggaacagaagaatgctgggaacagaactaac
gaggggcctctcattgtcaccgaagaacttcactctcttagctttgaaacccagttgtgc
cagccaggcttggtgattgacctggagaccacctctcttcctgtcgtggtgatctccaac
gtcagccaactccccagtggctgggcatctatcctgtggtacaacatgctggtaacagag
cccaggaatctctccttcttcctgaaccccccgtgtgcgaggtggtcccagctctcagag
gtgttgagttggcagttttcatcagtcaccaagagaggtctgaacgcagaccaactgagc
atgctgggagagaagctgctgggccctaatgctggccccgatggtcttattccatggaca
agattttgtaaggaaaatatcaatgataaaaatttttccttctggccttggattgacacc
atcctcgagcttattaagaagcacctgttgtgcctctggaatgatgggtgcattatgggc
ttcatcagcaaggatcgagaacgcgctctgctcaaggatcagcagccagggacattcctg
ctcaggttcagtgagagctcccgggaaggggccatcacgttcacatgggtggaacggtcc
caaaacggaggggaacccgacttccatgctgtcgagccctacacgaaaaaagaactttca
gctgttaccttcccagatattattcgcaactacaaagtcatggctgccgagaatatacca
gagaaccccctgaagtacctgtaccccaatattgacaaagaccatgccttcgggaagtac
tattccagaccaaaggaagcaccagaaccgatggagcttgacgaccccaagagaactgga
tacatcaagactgagttgatttctgtgtctgaagtccacccttctagacttcagaccaca
gacaacctgcttcccatgtctccagaggagtttgatgagatgtcccggatagtgggctct
gagtttgacagtatgatgagcacagtataa

DBGET integrated database retrieval system