KEGG   Mus pahari (shrew mouse): 110321146
Entry
110321146         CDS       T05929                                 
Symbol
Icos
Name
(RefSeq) inducible T-cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04660  T cell receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321146 (Icos)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110321146 (Icos)
   04672 Intestinal immune network for IgA production
    110321146 (Icos)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    110321146 (Icos)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110321146 (Icos)
CD molecules [BR:mpah04090]
 Proteins
  110321146 (Icos)
SSDB
Motif
Pfam: V-set_2 Ig_2
Other DBs
NCBI-GeneID: 110321146
NCBI-ProteinID: XP_021052880
Ensembl: MGP_PahariEiJ_G0027431
LinkDB
Position
5:40174204..40193481
AA seq 193 aa
MKPYLCCVFVFCFLTRLLTGEINGSANHRMFSFHNGDVQISCKYPENVQQLQMRLFRERE
VLCDLTKTKGSGNVESIKNPMFCSYQLFNNSVSFFLNNPDSSQGSYYFCRLSIFDPPPFL
EKNLSGGYLYIYESQLCCQLKLWLPIGCAAFVVVLLFGCILTIWFTKKKHGSSVHDPSSE
YMFMAAVNTNKKS
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaagccgtacctctgttgtgtctttgtcttctgcttcctaaccagacttttaacagga
gaaatcaatggctcggccaatcatcggatgttctcatttcacaatggagatgtacagatt
tcttgtaaataccctgagaatgtccagcagttacaaatgcgattgttcagagagagagaa
gtcctctgtgacctcaccaagaccaagggaagcggaaatgtggagtccatcaagaatccg
atgttctgttcatatcagctgttcaacaacagtgtctcttttttcctaaacaacccagac
agctcccagggaagctattacttctgcagactgtccatttttgacccacctccttttcta
gaaaagaaccttagtggaggatatttgtatatttatgaatcccagctctgctgccagctg
aagctctggctacccatagggtgtgcagctttcgttgtggttctcctttttggatgcata
cttaccatctggtttacaaaaaagaagcacggatccagtgtgcatgaccctagtagtgaa
tacatgttcatggcggcagtcaacacaaacaaaaagtcttga

DBGET integrated database retrieval system