KEGG   Mus pahari (shrew mouse): 110321212
Entry
110321212         CDS       T05929                                 

Gene name
Cul3
Definition
(RefSeq) cullin-3 isoform X1
  KO
K03869  cullin 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110321212 (Cul3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110321212 (Cul3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110321212 (Cul3)
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110321212 (Cul3)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     110321212 (Cul3)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     110321212 (Cul3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N
Other DBs
NCBI-GeneID: 110321212
NCBI-ProteinID: XP_021052995
Ensembl: MGP_PahariEiJ_G0027559
LinkDB
Position
5
AA seq 768 aa
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESF
NNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYL
AKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtcgaatctgagcaaaggcacgggcagccggaaggacaccaagatgcggatccgggcc
tttccgatgaccatggatgaaaaatatgtaaacagcatttgggaccttctgaaaaatgca
attcaagaaatccagcgtaagaataacagtggtcttagttttgaggagctctatagaaat
gcatatacaatggttttgcataaacatggagaaaagctctacactggactaagagaagtt
gttactgaacatctcataaataaggtgcgagaagatgtactaaattcattgaataacaac
tttcttcaaacactaaatcaagcttggaatgatcatcaaacagccatggtgatgattaga
gacatattaatgtatatggaccgtgtatatgtacaacagaataatgtagaaaatgtctac
aatttgggattaataatttttcgagatcaagttgtacggtatgggtgtattagggatcat
cttcggcaaactttattggatatgattgccagagagcggaaaggagaagttgtagacaga
ggagcaataagaaatgcttgccagatgttaatgattttaggtcttgaaggaagatcagtc
tatgaggaagattttgaggctccgtttttggaaatgtctgcagaattttttcagatggaa
agccagaaatttttagcagaaaacagtgcttcggtatatataaagaaagtagaagctagg
attaatgaggaaatagagcgggtgatgcactgccttgacaaatccacagaagagcctatt
gtgaaggtggtggagagggaactcatttccaagcacatgaagactattgtagaaatggaa
aattctgggctagtacatatgctgaaaaatggaaagacagaagaccttgcttgcatgtac
aaattatttagtcgtgtgccaaatggtttgaagaccatgtgtgaatgtatgagttcttat
ttgagggaacaaggaaaagcccttgtttctgaggaaggagaagggaagaatcctgttgac
tatatccagggcttattggatctgaagagtaggtttgatcgcttcctccaagaatccttc
aataatgaccggctctttaaacagactattgctggggacttcgagtatttcttaaacctc
aactctaggtctcctgaatacctctcattatttattgatgataaactgaaaaagggagtc
aaagggctaacagaacaagaagtagaaacaatattggataaggcaatggtcctttttagg
tttatgcaagaaaaagatgtatttgaacgttattataaacaacacctggcaagaagactg
ctcacaaataaaagtgtttctgatgactctgagaaaaatatgatttctaaattaaagact
gagtgtggatgtcaattcacatcgaaactggaaggaatgtttagggatatgagcatctca
aacacaactatggatgagttcaggcaacatctacaggcaacgggggtatctttaggtggt
gttgatctcacagtccgggttctcacaacgggatattggcctactcagtcagccacacca
aagtgcaacatcccaccagcaccaagacatgcttttgagatatttagaaggttctactta
gccaaacatagtggtcgacagctcacactccagcatcacatgggttctgcagatctcaat
gccaccttttatggtccagttaaaaaggaagatggatctgaggttggcgttggtggtgca
caagtaactggttctaatacacggaagcacatactgcaagtctccactttccagatgacc
atattaatgctttttaataatagagagaaatacacatttgaggaaattcaacaggagaca
gatatccctgaaagagaacttgttagagccctccagtccctcgcctgtggtaaaccaacc
caacgggtcctcacaaaagaacccaagtccaaggagatagaaagtggccacatatttaca
gttaatgatcaattcacatccaaactacacagagtcaagattcaaacagttgcagccaaa
caaggtgaatccgacccagaaaggaaagaaacaagacagaaagtagatgatgacagaaaa
catgagatagaagctgctatagtgcgaataatgaagtctaggaagaagatgcagcacaat
gttttagtagcagaggtaactcagcaactgaaggctcgattcttaccaagtccagttgtt
attaagaaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggat
cgcaaagtatacacatacgtagcataa

DBGET integrated database retrieval system