KEGG   Mus pahari (shrew mouse): 110321821
Entry
110321821         CDS       T05929                                 

Gene name
Gpr161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110321821 (Gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110321821 (Gpr161)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    110321821 (Gpr161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx IF-2
Other DBs
NCBI-GeneID: 110321821
NCBI-ProteinID: XP_021054000
Ensembl: MGP_PahariEiJ_G0028040
LinkDB
Position
5
AA seq 528 aa
MSLNSSLSYRKELSNLTSTEGGEGGAVSEFIAIIIITVLVCLGNLVIVVTLYKKSYLLTL
SNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGVI
AIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVAA
WHREPGYTIFWQIWCALFPFLIMLVCYGFIFRVARVKARKVHCGTVVTVEEDSQRSGRKN
SSTSTSSSGSRRNALQGVVYSANQCKALITILVVIGAFMVTWGPYMVVITSEALWGKNYV
SPTLETWATWLSFTSAICHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSI
SNRITDLGLSPHLTALMAGGQSLGHSSSTGDTGFSYSQDSGTDVMLLEDGTSEDNLPQHC
TCPPKRRSSVTFEDEVEQIKEAAKNSLLHVKAEVHKSLDSYAASLAKAIEAEAKINLFGE
EALPGVLFTARTVPGASFGGRRGSRTLVNQRLQLQSIKEGNVLAAEQR
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgagcctcaactcctccctcagctacaggaaggaactgagcaacctcacatcgacagag
ggtggtgaagggggtgctgtttctgagttcatcgccatcatcatcatcactgtcctcgtc
tgcctgggcaacctggtcattgtcgtcaccttgtacaagaagtcctacctcctcaccctc
agcaacaagttcgtcttcagcctgaccttgtccaacttcctgttgtccgtgctggtgctg
ccgttcgtggtgactagctccatccggagggaatggatcttcggtgtggtctggtgcaac
ttctctgcccttctctacctgctgatcagctcagccagcatgctcacccttggggtcatt
gccatcgatcgctactacgctgtcctgtatccaatggtgtaccccatgaagatcacaggg
aaccgagctgtgatggctctcgtctacatctggctccactctctcattggctgtctgccg
cccctatttggctggtcatcggtggagtttgatgagttcaagtggatgtgtgtggccgcg
tggcaccgggaaccgggctacaccatcttctggcagatctggtgtgccctgtttcccttt
ctcatcatgctagtatgctacggtttcatcttccgggtagctagggtcaaggcccgaaag
gtgcactgtggcacggtggtcactgtggaggaggactcccagaggagcgggaggaagaat
tctagtacctccacctcttcctccggcagtaggaggaatgcccttcagggagtggtctat
tcagctaaccagtgcaaagccctcattaccatcctagtggtcattggtgccttcatggtc
acctggggcccctacatggttgtcattacctcagaagcactctgggggaagaactatgtc
tccccaaccctggagacttgggccacatggctttcctttaccagtgccatctgtcaccct
ctgatctacggactctggaacaagactgtgcgcaaggagctgctgggcatgtgctttggg
gaccgttattaccgggaaccctttgtgcagcgacagaggacctccaggctcttcagcatt
tccaacaggatcacagacttgggcctgtccccacacctcacggcgctcatggcaggcgga
cagtccctgggacacagcagcagcaccggcgacacaggcttcagctactctcaggattca
gggacggatgtgatgctgttggaagatggcacttctgaggacaaccttccccagcactgc
acttgcccacccaagaggaggagctccgtgacatttgaggatgaagtggaacagatcaaa
gaggctgccaagaactctcttcttcatgtgaaagccgaagtacacaaatccttggacagt
tatgcagccagcttggctaaagccattgaggctgaagccaaaatcaacttatttggggag
gaggctctgccaggggtcttgttcacagcacggactgtccctggggctagctttgggggc
cgtcgaggcagcaggactcttgtgaatcagaggctgcagctacagagcatcaaagaaggg
aatgtcttagctgcagaacagagatga

DBGET integrated database retrieval system