KEGG   Mus pahari (shrew mouse): 110321853
Entry
110321853         CDS       T05929                                 
Symbol
Sell
Name
(RefSeq) L-selectin isoform X1
  KO
K06495  selectin, lymphocyte
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321853 (Sell)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110321853 (Sell)
   04090 CD molecules [BR:mpah04090]
    110321853 (Sell)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110321853 (Sell)
   04091 Lectins [BR:mpah04091]
    110321853 (Sell)
Cell adhesion molecules [BR:mpah04515]
 Selectins
  Selectin family
   110321853 (Sell)
CD molecules [BR:mpah04090]
 Proteins
  110321853 (Sell)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   110321853 (Sell)
Lectins [BR:mpah04091]
 C-Type lectins
  Group 4: Selectins
   110321853 (Sell)
SSDB
Motif
Pfam: Lectin_C Sushi EGF EGF_2
Other DBs
NCBI-GeneID: 110321853
NCBI-ProteinID: XP_021054064
Ensembl: MGP_PahariEiJ_G0028027
LinkDB
Position
5:136793971..136813468
AA seq 372 aa
MVFPWRCQGTHWGSWSILKLWVWTLLFCDFLTHHGTHCWTYHYSEKPMNWENARKFCKQS
YTDLVAIQNKREIEYLEKTLPKNPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPN
NKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTC
ICDGGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSRCAFKCSEGREPLGTTETQ
CGASGNWSSPEPVCQVVQCEPLEAPELGTMDCIHPLGNFSFQSRCAFKCSEGREPLGTAE
TQCGASGNWSSPEPVCQETNRSFSKIKEDDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSQERMDDPY
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggtgtttccatggagatgtcagggtactcattggggctcatggagcatcctcaagctg
tgggtctggacactgctcttttgtgatttcctgacacaccatggaactcactgttggact
taccattattctgaaaaacccatgaactgggaaaatgctagaaagttctgcaagcaaagt
tacacagatttagttgccatacaaaacaagagagaaattgagtatttagagaagacatta
cccaaaaacccttattactactggataggaatcaggaaaattggaaaaatgtggacctgg
gtgggaaccaacaaaactctcactaaagaagcagagaactggggtgctggggagcccaac
aacaagaagtccaaggaggactgtgtggagatctatatcaagagggaacgagactctggg
aaatggaatgatgacgcctgtcacaaacgaaaggcagctctctgctatacagcctcttgc
cagccagggtcttgcaatggccgtggagaatgtgtggaaactatcaacaatcacacctgc
atctgtgatggagggtattatgggccgcagtgtcagtatgtggtccagtgtgagcctttg
gaggcccctgagttgggtaccatggactgcatccatcccttgggaaacttcagcttccag
tccaggtgtgctttcaagtgctctgagggaagagagccacttgggactacagaaacacag
tgtggagcttctggaaactggtcatctccagagccagtctgccaagtggtccagtgtgag
cctttggaagcccctgagttgggtaccatggactgcatccatcccttgggaaacttcagc
ttccagtccaggtgtgctttcaagtgctctgagggaagagagccacttgggactgcagaa
acacagtgtggagcttctggaaactggtcatctccagagccagtctgccaagagacaaac
agaagtttctcaaagatcaaagaagacgactacaaccccctcttcattcctgtagccgtc
atggtcaccgcattctcggggctggcgtttatcatttggctggcaaggcggttaaaaaaa
ggcaagaaatctcaagaaaggatggatgatccatactga

DBGET integrated database retrieval system