KEGG   Mus pahari (shrew mouse): 110321922
Entry
110321922         CDS       T05929                                 
Symbol
Cflar
Name
(RefSeq) CASP8 and FADD-like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04064  NF-kappa B signaling pathway
mpah04140  Autophagy - animal
mpah04210  Apoptosis
mpah04217  Necroptosis
mpah04668  TNF signaling pathway
mpah05142  Chagas disease
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110321922 (Cflar)
   04668 TNF signaling pathway
    110321922 (Cflar)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110321922 (Cflar)
  09143 Cell growth and death
   04210 Apoptosis
    110321922 (Cflar)
   04217 Necroptosis
    110321922 (Cflar)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110321922 (Cflar)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110321922 (Cflar)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110321922 (Cflar)
Peptidases and inhibitors [BR:mpah01002]
 Cysteine peptidases
  Family C14: caspase family
   110321922 (Cflar)
SSDB
Motif
Pfam: DED Peptidase_C14 NAD_binding_6 HTH_20
Other DBs
NCBI-GeneID: 110321922
NCBI-ProteinID: XP_021054181
Ensembl: MGP_PahariEiJ_G0027407
LinkDB
Position
5:37875920..37920554
AA seq 484 aa
MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAPPNLRDLLDSLSERGQLTFAAL
AELLYRVRRFDLLKRILKTDKATVEDHLCRNPHLVSDYRVLLMEIGENLDQSDVSSLVFI
TRDYTGRGKVTKDKSFLDLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSS
KEARSNMNTVQASLPKLSIKEQLYNSRLQNGRSKEPRCVEHRGIQRKLVKTSIQESGAFL
SPHIREETYRMQSRPLGICLIIDCIGNDTEHLQETFTSLGYRVQPFLFPKSRDITQIVRR
FACMTQHQDYDSFVCVLVSLEGSQSMMGRDQVRSGFSLDCVKNMFTGDTCPSLRGKPKLF
FIQNYESLGSQLEDSSLEIDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADKSHLEKP
SSASSVYLQKLSQQLKQDRKRPLVDLHVELMNKVYAWNSGVSSKEKYNLSLQHTLRKKLI
LSPA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcccagagccctgtgtctgccgaggtcattcaccaggtggaagagtgtcttgatgaa
gatgagaaggagatgatgctcttcctgtgtagagatgtgactgagaacctggctccacct
aacctcagggacctcctggatagcttaagtgagagaggccagctcacttttgctgccttg
gctgaactgctctacagagtgaggcggtttgacctgctcaagaggatcttgaagacagac
aaagcaaccgtggaggaccacttatgcagaaaccctcacctggtttctgattatagggtc
ctgttgatggagatcggtgagaatttggatcagagtgatgtctcctccttagttttcatt
acaagggattacacaggcagaggcaaggtaaccaaggacaagagtttcttggatctggtg
attgaattggagaagctgaatctgattgcttcagaccaattgaatttattagaaaaatgc
ctgaagaacatccacagaatagacttgaacacaaagatccagaagtacacccagtccagc
aaagaagcaagatcaaatatgaatactgtccaggcttcgctcccaaaattgagtataaag
gaacaattatataactcaaggctccagaatgggcgaagtaaagagccaagatgtgtggaa
caccgtggcattcaaagaaaactggtgaagacatctatccaggaatcaggagccttttta
tctccgcacatccgtgaagagacttacaggatgcagagcaggcccctaggaatctgcttg
atcattgattgtattggcaacgacacagaacatcttcaagagaccttcacttccctgggc
taccgtgtccagcctttcttgtttcccaagtcacgtgacataacccagatcgttcgccga
tttgcctgtatgacccaacatcaagactatgacagctttgtatgtgttctggtgagccta
gaaggctcccaaagcatgatgggcagagatcaagttcgctcagggttctccttggattgt
gtcaagaacatgttcacgggggacacgtgcccttctctcagagggaagccaaagctcttt
tttattcagaactacgagtcgttaggtagccaattggaagatagcagcctggagatagat
gggccatcaataaaaaatgtggactctaagcccctgcaacccagacactgcacaactcac
ccagaggctgatatcttttggagcctgtgcacagcagacaaatctcacttggagaagccc
tccagcgcgtcttctgtgtatctgcagaaactctcccagcagctgaagcaagacaggaaa
cgcccactcgtggatctccacgttgaactcatgaacaaagtgtatgcgtggaacagcggt
gtctcttctaaagagaaatacaacctcagcctgcagcacactctgagaaagaagctcatc
ctgtctcctgcatga

DBGET integrated database retrieval system