KEGG   Mus pahari (shrew mouse): 110322014
Entry
110322014         CDS       T05929                                 
Symbol
Cfh
Name
(RefSeq) complement factor H
  KO
K04004  complement factor H
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322014 (Cfh)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110322014 (Cfh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322014 (Cfh)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110322014 (Cfh)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 110322014
NCBI-ProteinID: XP_021054229
Ensembl: MGP_PahariEiJ_G0027906
LinkDB
Position
5:complement(114260470..114334783)
AA seq 1188 aa
MVQHTLLFKSIGPGKIQNMRLSARIIWLILWTVCVAEDCKGPPPRENSEILSGSWSEQLY
PEGTQATYKCRPGYRTLGTIVKICRSGKWVAFNPSRICRKRPCGHPGDTPFGSFRLEVGS
QFEFGAKVVYTCDDGYQLLGEIDYRECGADGWINDIPICEVVKCLPVTEVENGRIVSGAA
ETDQEYHFGQVVRFECNSGFKIEGQKEMHCSENGLWSNEKPRCVEILCTPPQVENGDGIN
AKPIYKENERYHYKCKHGYVPKERGDAICTGSGWSPQPSCEEKTCSPPIIPNGFYTPHRI
THRTDDEIRYGCNYDFYPVTGSTVSKCTXDGWMPVPRCTWKCVFHYVQNGKSSYWEEIYM
QGQSVKVQCHSGYSLPNXQDTITCTENGWSTPPKCILIKTCSVSDIDIENGFFSESDGTY
DLNRVTSYRCKQGYVTNTGETSGSITCLQNGWSLQPSCIKSCDMPVFENSVTKNNNTWFK
INDKLDYECFIGYENEYKQTKGSITCTYNGWSDTPSCYERECSVPTLDTKLIVSPKKDKY
RVGDLLEFSCSSGHRVGPDSVQCYHFGWSPSFPTCKGQVASCAPPLEILNGEINGTKSVE
YRHGEVVGYDCKPRFLLKGPNKIQCVDGKWTTYPVCVEEERTCGDIPKLEHGSVKVSDPP
YYHGDSVEFTCVKTFTMIGHGSIFCISGKWTQLPKCVATDQLEKCRAPIKSTDIEAIKPA
KNEFNHNSIVGYKCRDKQEYEHSICINGKWNPEPNCTRKTSCPPPPQIPNTQVIETTVNY
LDGEKLSVLCKDNYLTQDSEEMVCEDGRWQSLPRCIEKIPCSQPPTIEHGSIKLPRSSEE
RRDSIESSSHEHGXTFSYVCDDGYRIPEENGVTCYMGKWSTPPRCVGLPCGPPPSIPLGI
VSHELESYQHGEXXTYQCXKGFGIDGPXFIKXEGGKWSEPPECKKTDCDILPTVENAIMT
GKKKKSYSTGEQVTFRCQPHYQMNGSDTVTCINSRWIGQPVCKADYCVNPPHVLNATIVT
MLKAKYPAGERVHYECHKPFELFGNVEVMCQNGMWTEPPRCKDPTGKCGPPPTIDNGDIT
SLSLPVYASLSSVEYQCQKYYLLKGNRTITCRNGKWSEPPTCLSACVISEDILERHNIFL
XWRQSEKFYSQSGXVIEFXCKPGYTXAXGSPXFRAKCMNGHINYPTCE
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggtacagcacacacttctcttcaagtcaattggtcccggaaagatccaaaatatgaga
ctgtcagcaagaattatttggcttatattatggactgtttgtgtagcagaagattgtaaa
ggtcctcctccaagagaaaattcagaaattctgtcaggctcgtggtcagaacaactatat
ccagaaggcacccaggctacctacaaatgccgccctggataccggacacttggtactatt
gtgaaaatatgcaggagtggaaaatgggtggcttttaacccatccaggatatgtcggaaa
aggccatgtgggcatcccggagatacaccctttggatcctttaggctggaagttggatct
caatttgagtttggtgcaaaggttgtttatacctgtgatgatggctatcaactgttgggt
gaaattgattaccgtgaatgtggtgcagatgggtggataaatgatattccaatatgtgaa
gttgtgaagtgcttacctgtgacagaagtcgaaaatggaagaattgtgagtggtgcagca
gaaacagaccaggaataccattttggacaggtggtgcggtttgaatgcaactcaggcttc
aagattgaaggacagaaggaaatgcattgctcagaaaatggtctttggagcaatgaaaag
ccacgatgtgtggaaattctctgcacaccaccacaagttgaaaatggagatggtataaat
gcgaaaccaatttacaaggagaatgaaagataccactataagtgtaagcatggttatgtg
cccaaagaaagaggagatgcaatctgcacaggttctggatggagtcctcagccttcctgt
gaagaaaagacatgctcgcctcctattattccaaatggtttctacacacctcacaggatt
acacacagaactgatgatgaaatcagatatggatgtaattatgacttctatcctgtaacc
ggatcaactgtttcaaagtgtacaatngatggctggatgcctgttccaagatgtacctgg
aaatgtgttttccattatgtgcagaatggaaaatcttcatactgggaagaaatatatatg
cagggtcagtctgtaaaagtccagtgtcacagtggctatagtcttccaaatgntcaggac
acaattacatgtacagagaatggctggtcgactcctccaaaatgcatccttatcaagaca
tgttcagtatcagatatagacattgagaatggttttttttctgaatctgatggtacatat
gatctaaatagagtaacatcatatagatgtaaacaaggatatgtgacaaatactggagaa
acatcaggatcaattacttgccttcaaaatggatggtcacttcaaccctcatgcattaag
tcttgtgatatgcctgtatttgagaattctgtaactaagaataataacacatggtttaag
atcaatgacaaattagactatgaatgttttattggatatgaaaatgaatataaacagacc
aaaggctctataacatgtacttataatggatggtctgatacgccctcatgttatgaaaga
gaatgcagtgttcccactctagacacaaaactaatcgtttctccaaaaaaagacaaatac
agagttggagatctgttggaattctcttgcagttcaggacaccgagtgggaccagattca
gtgcaatgctaccactttggatggtctcctagtttccctacatgtaaaggtcaagtagca
tcatgtgcaccacctcttgaaattcttaatggggaaattaatggaacaaaaagtgttgaa
tacagacacggtgaggtggtgggatatgattgcaaacctagattcctactgaagggaccc
aataaaatccagtgtgttgatgggaagtggacaacctatcctgtgtgtgttgaggaagag
agaacatgtggagacattcctaaacttgagcatggttctgtcaaggtttctgaccctccc
tactaccatggagattcagtggagttcacttgtgtaaagactttcacaatgattggacat
gggtcaattttttgcattagtggaaagtggacccagctccctaaatgtgttgcaacagat
caactggagaagtgtagagcacctattaagtcaactgacatagaagcaattaaaccagct
aagaatgaatttaatcataactctatcgtgggttacaaatgtagagacaagcaggagtat
gaacattcaatctgtatcaatggaaaatggaatcctgaaccaaactgtacaaggaaaaca
tcctgccctcctccaccncagattccaaatacccaagtgattgaaaccactgtgaactac
ttggatggagaaaaattatctgttctttgcaaagacaattacctaactcaggactcagag
gaaatggtgtgcgaagatggaaggtggcagtcattacctcgctgcattgaaaaaattcca
tgttcccagccccctacaatagaacatggatctattaaattacccagatcttctgaagaa
aggagagattccattgagtccagcagtcatgaacatgganctacattcagctatgtctgt
gatgatggttacaggatacctgaagaaaatggggtaacctgctacatgggaaaatggagc
actccacctcgctgtgttggacttccttgtggacctccaccttcaattcctcttggaatt
gtttctcatgagctagagagttaccaacatggagaaaangntacataccagtgttntaaa
ggctttggaattgatggaccagnatttattaaatgngaaggaggaaagtggtctgaacca
ccagaatgcaaaaaaacggattgtgacattttacccacagttgaaaatgccataatgaca
ggaaagaaaaaaaaatcatatagcacaggagaacaagtgacattcagatgtcaacctcat
tatcaaatgaatggctcagacactgtaacatgtattaacagccggtggattggacagcca
gtatgcaaagctgattactgtgtgaatccacctcatgtgttgaatgctactatagtaaca
atgctcaaggccaaatatcccgctggtgagagagtacattatgaatgtcataaacctttt
gaactatttgggaatgtggaagtgatgtgtcaaaatgggatgtggactgaaccaccaaga
tgcaaagacccaacagggaaatgtgggcctcctccaactattgacaatggagacatcacc
tccttgtcattaccagtatatgcatcattatcatcagttgaatatcagtgtcagaaatat
tatctacttaaaggaaataggacaataacatgtagaaatggaaagtggtctgagccacca
acctgtttatctgcatgtgtaatatcagaagacattctggaaagacataacatatttctc
anatggagacaaagtgaaaaattttattctcaatcaggggangttattgaatttntgtgt
aaacctggatatacacnagcaagnggatcaccancatttcgtgcaaagtgtatgaatggt
cacatcaattatcccacttgtgaataa

DBGET integrated database retrieval system