KEGG   Mus pahari (shrew mouse): 110322113
Entry
110322113         CDS       T05929                                 
Symbol
F5
Name
(RefSeq) coagulation factor V
  KO
K03902  coagulation factor V (labile factor)
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110322113 (F5)
SSDB
Motif
Pfam: F5_F8_type_C Cu-oxidase_3 Cu-oxidase_2
Other DBs
NCBI-GeneID: 110322113
NCBI-ProteinID: XP_021054295
Ensembl: MGP_PahariEiJ_G0028029
LinkDB
Position
5:136884575..136954571
AA seq 2096 aa
MLPVCPRFFLLVVLGTRWAGWGSHQAEAARVRQFYVAAQGILWNYHPEPTDPSLNSIPSF
KKIVYREYEPYFKKEKPRASNSGLLGPTLYAEVGDIIKVHFRNKADKPLSIHPQGIKYSK
FSEGASYPDHTSPAERKDDVVAPGEEYTYDWIVSEDSGPTPDDPPCLTHIYYSYENLTQD
FNSGLIGPLLICKKGTLTEDGTQKMFDKQHVLLFAVFDESKSWSQSPSLMYTINGFVNRT
MPDITVCAHDHVSWHLIGMSSGPELFSIHFNGQVLEQNQHKVSTVTLVSATSTTANMTMS
PEGKWIVSSLIPKHYQAGMQAYIDIKNCPKKTRSPKTLTREQRRHMKRWEYFIAAEEVIW
NYAPVIPANMDKIYRSLHLDNFSNQIGKHYKKVIYRQYEEETFTKRTDNPSIKQSGILGP
VIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDGVNSSSTSGNHTMIRPVQPGETFT
YKWNILEFDEPTENDAQCLTRPYYSDVDVTRDIASGLIGLLLICKSRSLDQRGVQRVADI
EQQAVFAVFDENKSWYIEDNINKFCENPEEVKRDDPKFYESNIMSTINGYVPESISTLGF
CFDDTVQWHFCSVGTHDDILTIHFTGHSFIYGRRHEDTLTLFPMHGESVTVTMDNVGTWM
LTTMNSNPKRRNLRLRFRDVKCIRDYDNDDSYEIYKPLAPTSMTTRKIHDSLENELGADD
EDYDYQSILASSLGIRSFRNSSLNPEENEFNLTALALENSSEFISPSTDRVVDSNSSRIL
SKFTSNNLKGSQRTHPGSGATVAGTLLGNLIGLDENFVLNPSIEHRSSSYHENAMENPQS
NITVVYLLPLGPKGSGSREQAKPKTIKTGRPHMMKHRFSWMKAPAGKTGRHSNPKNTYSR
MKSEEDIPSDLLLLKQNITSKFLNRRWRVASEKASYEIIPANGEDTDVDKLTNSPQNQNI
TMPWGESTAHTNTTRKPSNLPTFSGVRHKSPRVRQEEENGGFQKRQLFIRTRKKKKNKKL
ALHSPLSPRGFYPLRGDDHLPFSDRRLLNHSLLLRKFNDTALSTDLNQTSPSMSMDRSFP
DYNQYASNDTEQMSSSLDLYQSVPPVEHSPTLPAQDPDQTHSTTDPSYRSSPPEHSQGLD
YDLSHEFDPDDIGQTSFFPNQSQKSSLSSDDDQEIPSSDLTLFTISPELDQTIIYPDLDQ
LLISPDDNQNTSSPDLGQVPLFPDDNQNYFLDLGQIHLSSDQNQETSSTDLSLLTLSPDF
GQTVLPPDLDQLPLSSDNGQVTLSPDLSLLTLSPDFNEIILSPDLGQVTLSPDLIQTNPA
LNHQHKTSSADPDQASYPPDSGQASSLPELNQTLPHPDLIHIPPPLPSPTLNNTSLSRKF
NPLVVVGLSRVDGDDVEIVPSEELQRIDEDYAEDDYVTYNDPYRTDIRTDVNSSRDPDTI
AAWYLRSHGGNKKFYYIAAEEISWDYSKFAQSEMDHEDIGHTAKDTTYKKVVFRKYLDST
FARRDPRAEYEEHLGILGPVIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKIYD
DESPEWFQEDDAVQPNSSYTYVWHATERSGPENPGSACRAWAYYSAVNVERDIHSGLIGP
LLICRKGTLHRESNLPMDRREFVLLFMVFDEKKSWYYEKSKGSWRIESPEAKNSHEFYAI
NGMIYNLPGLRMYEQEWVRLHLLNLGGSRDIHVVHFHGQTLLDNRTKQHQLGVWPLLPGS
FKTLEMKASKPGWWLLDTEVGENQVAGMQTPFLIIDKECKMPMGLSTGVISDSQIKASEY
LTYWEPRLARLNNAGSYNAWSIEKTALDFPIKPWIQVDMQKEVVVTGIQTQGAKHYLKSC
FTTEFQVAYSSDQTNWQIFRGKSRKNVMYFTGNSDASTIKENRLDPPIVARYIRIHPTKS
YNRPTLRLELQGCEVNGCSTPLGLEDGRIQNKQITASSFKKSWWGDYWEPSLARLNAQGR
VNAWQAKANNNKQWLQVDLLKIKKVTAIVTQGCKSLSSEMYVKSYSIQYSDQGVAWKPYR
QKSSMVDKIFEGNSNTKGHMKNFFNPPIISRFIRIIPKTWNQSIALRLELFGCDIY
NT seq 6291 nt   +upstreamnt  +downstreamnt
atgctcccagtctgcccgcgcttcttcctcctggtggttctgggcacccgctgggcgggc
tggggcagccaccaggcagaggccgcgcgggtaaggcagttctatgtggctgctcagggg
atcctctggaactatcatcctgagcccacagatccaagtttgaattctataccttccttc
aagaaaattgtctacagagagtatgagccatattttaagaaagaaaaaccacgagctagc
aactcaggacttcttggacctactttatacgctgaagttggtgacatcattaaagttcac
ttcagaaacaaagcagacaaaccgctaagcatccatcctcaagggattaagtacagtaaa
ttttcagaaggggcttcctacccagaccacacatcccctgccgagaggaaggatgatgtc
gtggctcctggagaagaatacacctatgactggatcgtcagtgaggacagcgggcccacg
cctgatgacccaccatgcctcacccacatctactattcctatgagaacctgacccaggat
ttcaactcgggtctgattgggcctctgcttatctgcaagaaaggcaccctgactgaggat
gggactcagaagatgtttgacaagcaacatgtacttctgtttgctgtgtttgatgaaagc
aagagctggagccagtcaccatccctaatgtacacaatcaatggctttgtgaacaggacg
atgccagatataacagtctgtgcccatgatcacgtcagctggcatctgatcgggatgagc
tcggggccagaattgttttctattcacttcaacggccaagtcttagagcagaaccagcat
aaagtgtccaccgtcactctggtcagcgcgacatctacgactgcaaacatgactatgagc
ccagaaggaaaatggattgtttcttctctcatcccaaagcattatcaagctgggatgcag
gcttacattgacattaaaaactgcccaaagaaaacaaggagccccaagaccctcactcga
gagcagaggcggcacatgaagaggtgggagtacttcatcgccgcagaggaggtcatttgg
aactatgcacctgtgatacctgcgaatatggacaaaatatacaggtctctgcacttggat
aatttctcaaaccaaattggaaaacattacaagaaagttatctataggcaatatgaagaa
gagaccttcaccaaacgcaccgacaaccccagcatcaaacaaagtgggattctgggccct
gttattagagcccaggtcagggacacactcaagatcgtgttcaaaaacatggcgagccga
ccctacagcatttaccctcacggggtgaccttctctccttacgaagatggagtcaattct
tcctccacctcaggcaatcacaccatgatcagaccggttcaaccgggggaaaccttcact
tacaaatggaacattctagagtttgatgaacccacggaaaatgatgcccagtgcctaaca
aggccatactacagtgatgtggacgttacaagggacattgcctctgggctgatagggctg
cttctaatttgtaagagcaggtccctagaccagaggggtgtacagagggtggcggacatc
gagcagcaggccgtgtttgccgtgtttgatgagaacaagagctggtacattgaggacaac
atcaacaagttttgtgagaatcccgaagaggtgaagcgtgatgatcccaagttttacgaa
tcaaacatcatgagcactatcaacggctacgtgcctgagagcatttccactctgggattc
tgttttgatgacactgtccagtggcacttctgcagtgtgggaactcatgatgatattttg
accatccacttcactggacactcgttcatctatgggaggaggcacgaggacaccttgacc
ctgttccccatgcatggtgaatccgtgacagtcacaatggataatgttggaacttggatg
ttgaccaccatgaattccaatccaaaacgcagaaacctgagactgaggttcagagatgtt
aagtgtatccgggattatgacaatgacgactcgtatgagatttataaacctcttgcacct
acatccatgacaactcggaaaattcatgattccttagaaaatgaacttggcgcagacgac
gaagattatgattaccagtccatactggcgtcatcactaggaattaggtcattcagaaac
tcatcattgaatccagaggaaaatgagttcaacctcacagctctcgctctagagaacagc
tctgagttcatatctccaagcacagacagagttgttgactcaaactcttcaagaatcctt
agtaagttcaccagtaataacctcaaaggctctcaaagaacacatcctggctcaggagcc
accgtggctggtaccctccttggaaacctcattggcttagatgagaacttcgtcctcaac
ccttctatagaacatcgttccagctcatatcatgaaaatgctatggaaaatccacagtca
aacatcacagtggtatacctacttcctcttggtccaaaaggatcagggagtcgagaacaa
gctaaacctaaaacaatcaagacaggaagaccccacatgatgaagcacaggttctcctgg
atgaaagctccagctggtaaaactgggaggcattcaaacccaaagaatacttattccaga
atgaagtctgaggaggacattcctagtgatttgttactcttaaaacaaaatatcacatcc
aaatttctgaatagacgatggcgtgtggcttctgaaaaggctagttatgaaataatacca
gcaaatggtgaagacacagatgttgataagctgacaaacagccctcaaaatcagaatatc
acaatgccttggggagagagcactgctcacacaaacacaacaagaaagccaagtaacctc
ccaacattttctggagttagacataaatctccacgtgtaagacaggaggaagaaaacggt
ggttttcagaaaagacagttatttatcaggacacggaagaagaagaagaataagaagctt
gcactacacagtcctctatctccaaggggcttttaccctttgagaggagatgaccatctc
ccattttcagacaggagactacttaatcactcactgttactccgcaagttcaatgacaca
gctctttctacagacctgaatcagacctccccttcaatgagtatggacaggtcatttcct
gactataatcagtacgcatcaaatgacactgagcagatgagctcttctttagatctttat
cagtcagtgcccccagtagaacattctccaacacttcctgcccaagatcctgatcaaaca
cactctaccacagatcctagctacagatcctctcctccagagcacagccaggggcttgat
tatgacctaagccatgaatttgaccctgatgacattggtcaaacatctttctttccaaac
caaagtcaaaagtcatctctctcttcagatgatgaccaagaaatcccttcctcagactta
accctctttaccatctctccagaattggatcagacaattatttacccagacctggatcag
ttgctcatttctccagatgacaaccagaacacctcctccccagacctgggtcaggtgcct
ctttttcctgatgacaaccagaattacttcctagacctgggtcagatacatctctcctca
gaccaaaaccaggagacctcctccacagaccttagcctactgactctctctcctgatttt
ggtcagacagtccttcccccagacttggatcagcttcccctctcttcagacaatggtcag
gtgaccctttccccagacctcagcctcttgaccctctcaccagattttaatgagataatc
ttatccccagaccttggtcaagtgaccctctctccagacctcatccagacaaaccccgct
cttaatcaccagcacaaaacatcctctgcagaccctgatcaagcatcctaccctcctgat
tctggtcaggcttcatcgcttccagaactgaatcagactcttccccatccagatctcatt
cacataccgcctcctttaccatctcccacactcaataacacttctttgtcgagaaaattt
aaccctcttgttgtagtaggtctcagtagagtggatggggacgacgttgagattgttcca
agtgaagagctacagagaatagatgaagattatgctgaggatgactatgtaacctataat
gacccctacagaacagacattaggacagatgtcaactcctccagagatcctgacactatt
gcagcatggtacctccgtagccacggtggaaacaaaaaattctactacattgcagctgaa
gaaatatcgtgggattactcaaagtttgcacaaagtgaaatggaccatgaagacataggc
cacactgcaaaggacaccacatacaagaaagtcgttttcagaaaataccttgatagcact
ttcgcacgtcgtgatcctcgggcagaatatgaggaacacctcggcattctcggtcctgtg
atccgggctgaagtggatgatgtgatccaagttcgatttaaaaatttggcatccagacca
tattctcttcatgcccacggactttcctatgaaaaatcctcagaggggaagatttatgat
gatgaatctcctgaatggtttcaggaagatgatgctgtccagcccaatagcagttacacc
tatgtatggcatgccaccgagcgctcggggccagagaaccctggctctgcctgccgggct
tgggcctactattctgcggtgaatgtggagagagacatccactcaggcttgatcggcccc
cttctgatctgccggaaaggaactcttcacagggagagcaacctgcctatggacaggaga
gagtttgtcttactcttcatggtctttgatgagaagaagagctggtactatgaaaagtcc
aaagggtcatggagaattgaatccccagaagcaaaaaattcccacgagttttatgcaatt
aatgggatgatctacaacctgcccggcctgagaatgtacgagcaagagtgggtgaggcta
cacctgctgaacctgggcggctcccgagatattcacgtggttcacttccacggccagacc
ctgctggataataggaccaaacagcaccagttaggggtctggccccttctgcctggttca
tttaaaactcttgaaatgaaggcatccaagcctggctggtggctcctagacacagaggtt
ggagaaaaccaggtagccggcatgcaaaccccatttctcatcatagacaaagagtgtaag
atgccaatgggactaagcactggtgtcatatctgattcacagatcaaggcttcggaatat
ctgacttattgggagcccagattagcacgattaaacaatgctggttcatataatgcttgg
agtatagaaaaaactgcattagattttcccattaaaccttggatccaggtggacatgcag
aaggaagttgtagtcaccgggatacaaacccaaggtgctaaacactacctaaagtcttgc
tttaccacggagttccaagtggcttacagctctgaccaaaccaactggcagatcttccga
gggaagagcaggaagaacgtgatgtattttactggcaattcagatgcctctacaataaaa
gagaatcgacttgacccaccgattgtggctagatacattaggatacacccaacaaaatcc
tataacagacccacccttcggctggagctgcagggctgtgaggtgaacggatgttctaca
ccactgggcctggaagatggaaggattcaaaacaagcaaattactgcatcttcatttaaa
aagtcatggtggggagactactgggagccttcccttgctcgcctgaatgcccagggcaga
gtgaacgcctggcaagccaaggcaaacaacaacaagcagtggttacaagtcgatctgctc
aaaatcaagaaggtaacagccattgtcacgcagggctgtaagtctctatcctctgagatg
tacgtgaagagctacagcatccagtacagcgaccagggtgtggcatggaaaccttacagg
cagaaatcttccatggtggacaagatttttgaaggaaatagcaacaccaaggggcacatg
aagaactttttcaacccgcccattatttccagatttatccgcatcattcctaaaacatgg
aaccaaagcattgcacttcgcctggaactctttggctgtgacatttattag

DBGET integrated database retrieval system