Mus pahari (shrew mouse): 110322134 Help Entry 110322134         CDS       T05929                                  Name (RefSeq) glutathione S-transferase A3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism mpah  Mus pahari (shrew mouse) Pathway mpah00480   Glutathione metabolism mpah00980   Metabolism of xenobiotics by cytochrome P450 mpah00982   Drug metabolism - cytochrome P450 mpah00983   Drug metabolism - other enzymes mpah01100   Metabolic pathways mpah01524   Platinum drug resistance mpah05200   Pathways in cancer mpah05204   Chemical carcinogenesis - DNA adducts mpah05207   Chemical carcinogenesis - receptor activation mpah05208   Chemical carcinogenesis - reactive oxygen species mpah05225   Hepatocellular carcinoma mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     110322134   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     110322134    00982 Drug metabolism - cytochrome P450     110322134    00983 Drug metabolism - other enzymes     110322134  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110322134    05204 Chemical carcinogenesis - DNA adducts     110322134    05207 Chemical carcinogenesis - receptor activation     110322134    05208 Chemical carcinogenesis - reactive oxygen species     110322134   09162 Cancer: specific types    05225 Hepatocellular carcinoma     110322134   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110322134   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110322134  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpah02000]     110322134 Enzymes [BR:mpah01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      110322134 Transporters [BR:mpah02000]  Other transporters   Pores ion channels [TC:1]    110322134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  110322134 NCBI-ProteinID:  XP_021054322 LinkDB All DBs Position 5:2851363..2879925 Genome browser AA seq 221 aa AA seqDB search MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEI DGMKLVQTRAIMNYIASKYNLYGKDMKERAIIDMYTEGVTDLEIMILYYPHMPPEEKEAS LAKIKEQARNRYFPAYEKVLKSHGQDYLVGNRLSRADVSLVELLYHVEELDPGVVDNFPL LKVLYSKVSNLPTVKKFLQPGSQRKPFDDAKCVESAKKIFS NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atggcggggaagccagtccttcactactttgatggcaggggaagaatggagcctatccgg tggctcttggctgcggctggtgtggagtttgaagaaaaatttctgaaaactcgggatgac ctggcaaggttacgaagtgatgggagtttgatgttccagcaagtgcccatggtagagatc gacgggatgaagctggtgcagaccagagccattatgaactacattgcctccaaatacaac ctctatgggaaggacatgaaggagagagccatcattgacatgtacacagaaggcgtgacg gatctggagataatgattctctattacccccacatgccccctgaggagaaagaggctagc cttgccaagatcaaggaacaagcaaggaaccgttacttccctgcctatgaaaaggtgttg aagagccatggacaagattatcttgttggcaacaggctgagcagggctgatgtttccctg gttgaactcctctaccatgtggaagagctggacccgggcgttgtggacaacttccctctc ctgaaggtactctattctaaagtcagcaacctccccacagtgaagaagtttcttcaacct ggcagccagaggaagccttttgatgatgcaaaatgtgtcgaatcagcaaagaagattttc agttaa

DBGET integrated database retrieval system