KEGG   Mus pahari (shrew mouse): 110322186
Entry
110322186         CDS       T05929                                 
Symbol
F11r
Name
(RefSeq) junctional adhesion molecule A
  KO
K06089  junctional adhesion molecule 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110322186 (F11r)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110322186 (F11r)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110322186 (F11r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110322186 (F11r)
CD molecules [BR:mpah04090]
 Proteins
  110322186 (F11r)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set C1-set C2-set_2 Adeno_E3_CR1 Ig_C17orf99
Other DBs
NCBI-GeneID: 110322186
NCBI-ProteinID: XP_021054408
Ensembl: MGP_PahariEiJ_G0028111
LinkDB
Position
5:143956140..143981818
AA seq 300 aa
MGTEGKAGRKLLFLFTSMILGSLVEGKGSVYTAQSDVQVPENESIKLTCTYSGFSNPRVE
WKFVQGGTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGE
VSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEQDGSPPSEYSWFKDGISMLTADAKKT
RAFINSSYTIDPKSGDLIFDPVTSFDSGEYYCQAQNGYGTAMRSEAVHMDAVELNVGGIV
AAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSARSEGEFKQTSSFLV
NT seq 903 nt   +upstreamnt  +downstreamnt
atgggcaccgaggggaaagccgggaggaaactgttgtttctcttcacgtctatgatcctg
ggctctttggtagaaggcaagggttcggtgtacactgctcaatctgatgtccaggttccc
gagaacgagtccatcaaattgacctgtacctactctggcttctccaatccccgcgtggag
tggaagttcgtccaaggcggcactactgcgcttgtgtgctataacagccagatcacagct
ccttatgccgaccgagtcaccttctcatccagtggtatcacgttcagttctgtgacccgg
aaagacaatggagagtatacttgcatggtctccgaggacggtggccagaactacggggag
gtcagcattcacctcactgtgcttgtgcctccatccaagccaacgatcagtgtcccctcc
tctgtcaccattgggaacagggcagtcctgacctgctcagaacaggatggttccccaccc
tctgagtattcctggttcaaggatgggatatccatgcttacagcagatgccaagaaaacc
cgggccttcatcaattcttcatacaccattgatccaaagtcgggggatctgatctttgac
cccgtgacatcctttgatagtggtgaatactactgccaggcccagaatgggtatgggaca
gccatgaggtcagaggctgtacacatggatgctgtggagctgaatgtggggggcatcgtg
gcagccgtcctggtaacactgattctcctcggactcttgatttttggcgtctggtttgcc
tatagccgtggatactttgaaagaacaaagaaagggactgcaccgggtaagaaggtgatt
tacagccagcccagtgctcgaagtgagggggaattcaaacagacctcgtcattcctggtg
tga

DBGET integrated database retrieval system