Mus pahari (shrew mouse): 110322571 Help Entry 110322571         CDS       T05929                                  Symbol Xcl2 Name (RefSeq) cytokine SCM-1 beta   KO K05507   C motif chemokine Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110322571 (Xcl2)    04061 Viral protein interaction with cytokine and cytokine receptor     110322571 (Xcl2)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     110322571 (Xcl2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110322571 (Xcl2) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110322571 (Xcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DUF7030 Motif Other DBs NCBI-GeneID:  110322571 NCBI-ProteinID:  XP_021054928 Ensembl:  MGP_PahariEiJ_G0028036 LinkDB All DBs Position 5:complement(137615094..137618802) Genome browser AA seq 114 aa AA seqDB search MRLPLLTFLGVCCLITCVVEGVGTEVLERSICVSLQTRRLPVQKIKTYTIKEGTMRAVIF VTKRGLKICADPEANWVKAAIKTVDGRASTRKNTAETVPTGAQRSTSTAITLTG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagacttcccctcctgactttcctgggagtctgctgcctcatcacatgcgttgtggaa ggtgtggggactgaagtcctagaaaggagtatctgcgtgagcttacaaacccggcggctt ccagttcaaaaaatcaagacctataccatcaaggagggaaccatgagagccgtgattttt gtcaccaaacgaggactaaaaatttgtgctgatccagaagccaactgggtgaaagcagcg atcaagactgtggatggcagggccagtacaagaaagaatacggcggaaactgttcccaca ggagcccagaggtccaccagcacagccataaccctgacggggtaa

DBGET integrated database retrieval system