Mus pahari (shrew mouse): 110322701 Help Entry 110322701         CDS       T05929                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05202   Transcriptional misregulation in cancer mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110322701  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110322701   09163 Immune disease    05322 Systemic lupus erythematosus     110322701   09165 Substance dependence    05034 Alcoholism     110322701  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110322701   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110322701 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110322701 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110322701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-S CENP-T_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  110322701 NCBI-ProteinID:  XP_021055102 Ensembl:  MGP_PahariEiJ_G0028213 LinkDB All DBs Position 5:complement(152973816..152983592) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAXLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaagtccactgaa cttctgatccgcaagctcccctttcagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctnt ctggttggcctttttgaagataccaatctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

DBGET integrated database retrieval system