Mus pahari (shrew mouse): 110322750 Help Entry 110322750         CDS       T05929                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism mpah  Mus pahari (shrew mouse) Pathway mpah03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     110322750  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110322750    03400 DNA repair and recombination proteins [BR:mpah03400]     110322750 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      110322750 DNA repair and recombination proteins [BR:mpah03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      110322750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone COMMD1_N TFIID-31kDa Bromo_TP DUF4087 TAF Motif Other DBs NCBI-GeneID:  110322750 NCBI-ProteinID:  XP_021055145 Ensembl:  MGP_PahariEiJ_G0029159 LinkDB All DBs Position 6:complement(100097478..100106047) Genome browser AA seq 142 aa AA seqDB search MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVALDKKVHFSKQTIAAISEVTFRQCENF AKDLEIFARHAKRSTVTTEDVKLLARRSNSLLKYITKKNEEIAQLNLERKAKKKRKPEDE SGSSREPGTEELGGAEELGIES NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggaggaggtggaggctgaggagccgcaggagttctctcaccggcagaggctgaaggcg gcagttcactacacagttggctgtctctgccaggaggtcgcactggacaaaaaggtacac ttcagcaaacagaccatcgcggcaatctccgaggtgacttttcgacagtgcgaaaatttt gccaaagaccttgaaatatttgccagacatgcgaaaagaagcacggttaccaccgaagac gtgaagctcttagcgagacggagtaattcactgctaaaatacattacaaagaagaatgaa gagatagctcagcttaacctggaacgaaaggccaagaagaaaagaaagccagaagatgaa agtgggagctctcgggagcccgggactgaggagctgggcggggctgaggagctgggcatc gagagctga

DBGET integrated database retrieval system