KEGG   Mus pahari (shrew mouse): 110322847
Entry
110322847         CDS       T05929                                 

Gene name
Cdc42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah04660  T cell receptor signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah04912  GnRH signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110322847 (Cdc42)
   04014 Ras signaling pathway
    110322847 (Cdc42)
   04015 Rap1 signaling pathway
    110322847 (Cdc42)
   04370 VEGF signaling pathway
    110322847 (Cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110322847 (Cdc42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110322847 (Cdc42)
   04520 Adherens junction
    110322847 (Cdc42)
   04530 Tight junction
    110322847 (Cdc42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110322847 (Cdc42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110322847 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    110322847 (Cdc42)
   04670 Leukocyte transendothelial migration
    110322847 (Cdc42)
   04062 Chemokine signaling pathway
    110322847 (Cdc42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110322847 (Cdc42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110322847 (Cdc42)
  09158 Development and regeneration
   04360 Axon guidance
    110322847 (Cdc42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322847 (Cdc42)
   05205 Proteoglycans in cancer
    110322847 (Cdc42)
   05203 Viral carcinogenesis
    110322847 (Cdc42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110322847 (Cdc42)
   05211 Renal cell carcinoma
    110322847 (Cdc42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110322847 (Cdc42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110322847 (Cdc42)
   05135 Yersinia infection
    110322847 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    110322847 (Cdc42)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110322847 (Cdc42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110322847 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322847 (Cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110322847 (Cdc42)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110322847 (Cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322847 (Cdc42)
   04031 GTP-binding proteins [BR:mpah04031]
    110322847 (Cdc42)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    110322847 (Cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    110322847 (Cdc42)
  Macropinocytosis
   Ras GTPases
    110322847 (Cdc42)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110322847 (Cdc42)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   110322847 (Cdc42)
  Exosomal proteins of breast milk
   110322847 (Cdc42)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    110322847 (Cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 110322847
NCBI-ProteinID: XP_021055357
Ensembl: MGP_PahariEiJ_G0029007
LinkDB
Position
6
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccaactgtttttgacaattat
gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg
caagaggattatgacagactacgacctctaagttatccacagacagatgtttttctagta
tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcgcgggatctgaaggctgtcaagtatgtggagtgctccgctctc
acacagaaaggcctaaagaatgtgtttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system