KEGG   Mus pahari (shrew mouse): 110322937
Entry
110322937         CDS       T05929                                 

Gene name
Prkcz
Definition
(RefSeq) protein kinase C zeta type
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04910  Insulin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05165  Human papillomavirus infection
mpah05415  Diabetic cardiomyopathy
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110322937 (Prkcz)
   04390 Hippo signaling pathway
    110322937 (Prkcz)
   04071 Sphingolipid signaling pathway
    110322937 (Prkcz)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110322937 (Prkcz)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110322937 (Prkcz)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110322937 (Prkcz)
   04062 Chemokine signaling pathway
    110322937 (Prkcz)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110322937 (Prkcz)
   04926 Relaxin signaling pathway
    110322937 (Prkcz)
  09158 Development and regeneration
   04360 Axon guidance
    110322937 (Prkcz)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110322937 (Prkcz)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110322937 (Prkcz)
   05415 Diabetic cardiomyopathy
    110322937 (Prkcz)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110322937 (Prkcz)
   04931 Insulin resistance
    110322937 (Prkcz)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322937 (Prkcz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110322937 (Prkcz)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110322937 (Prkcz)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110322937 (Prkcz)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like ABC1 C1_2 APH Kdo
Other DBs
NCBI-GeneID: 110322937
NCBI-ProteinID: XP_021055556
Ensembl: MGP_PahariEiJ_G0029235
LinkDB
Position
6
AA seq 592 aa
MPSRTDPKMDRSGDRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPLTC
RRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgcccagcaggacggaccccaagatggaccggagtggcgaccgtgtccgtctgaaggcg
cactacggcggggacatcctgattaccagcgtggatgccatgacaacgttcaaggacctc
tgtgaggaagtgcgagacatgtgtggcctgcaccagcagcacccactcaccctcaagtgg
gtggacagtgaaggtgacccttgtactgtgtcctcacagatggagctggaggaggccttc
cgcctggcctgtcagggcagggacgaagtgctcatcatccacgttttcccaagcatccca
gaacagccgggcatgccttgtcctggagaagacaaatccatctaccgccgtggagccaga
agatggaggaagctgtaccgagccaacggccacctcttccaagccaagcgctttaacagg
ggagcgtactgtggccagtgcagcgaaaggatatggggtctctcgaggcagggctacagg
tgcatcaactgcaagctgctggtccataaacgctgccacgtcctcgtcccgctgacctgc
aggaggcatatggattctgtcatgccttcccaggagcctccagtagatgacaagaacgat
ggtgtagaccttccttcagaagaaactgatggaattgcttatatttcttcatctcggaaa
catgataatatcaaagatgattctgaggaccttaagcctgtcatcgatggggtggatggg
atcaaaatctctcaggggctggggctacaagacttcgacctcattagagtcatcgggcgt
ggaagctatgccaaggtcctcctggtgcggttgaagaaaaacgaccagatttacgccatg
aaggtggtaaagaaggagcttgtccatgacgacgaggatatcgactgggtgcagacggag
aagcacgtgtttgagcaggcgtccagcaatcccttcctggttggcttacactcctgcttc
cagaccacaagccggttgtttctagtcatcgagtatgtcaatgggggggatctcatgttc
cacatgcagaggcagaggaagcttccagaggaacatgccaggttctatgctgctgagatc
tgtatcgctctcaacttcctgcacgagagggggatcatctaccgggacctaaaactggat
aacgtcctcctcgatgccgacggacacattaaactgacagactacggcatgtgcaaggaa
ggtctaggccccggtgatacaacaagcactttttgtggaaccccgaactatatcgcccct
gaaatcctgcgaggagaagagtacgggttcagcgtggactggtgggcactgggtgtcctt
atgtttgagatgatggctgggcgctccccctttgacatcatcacggacaaccctgacatg
aacactgaagactatcttttccaagttatcctggaaaagccaattcggattccccgtttc
ctgtctgtcaaggcctcacacgtcttgaaaggatttttaaataaggatcccaaagagagg
cttggctgccggccacagactgggttttccgacatcaagtcccacgctttcttccgcagc
atagactgggacctgctggaaaagaagcagaccctgcctcccttccagccccagatcaca
gatgactatggcctggacaactttgacacgcagttcaccagcgagcccgtgcagctgacc
ccagatgatgaggacgtcataaagaggatcgaccagtccgagtttgaaggctttgagtac
atcaacccgcttctgctgtctgctgaggagtccgtgtga

DBGET integrated database retrieval system