Mus pahari (shrew mouse): 110323225 Help Entry 110323225         CDS       T05929                                  Name (RefSeq) ubiquitin-like isoform X1   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mpah  Mus pahari (shrew mouse) Pathway mpah03010   Ribosome mpah04120   Ubiquitin mediated proteolysis mpah04137   Mitophagy - animal mpah04140   Autophagy - animal mpah05012   Parkinson disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     110323225   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110323225  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110323225    04137 Mitophagy - animal     110323225  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110323225    05167 Kaposi sarcoma-associated herpesvirus infection     110323225   09164 Neurodegenerative disease    05012 Parkinson disease     110323225    05022 Pathways of neurodegeneration - multiple diseases     110323225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mpah03011]     110323225    04121 Ubiquitin system [BR:mpah04121]     110323225 Ribosome [BR:mpah03011]  Ribosomal proteins   Eukaryotes    Large subunit     110323225   Archaea     110323225 Ubiquitin system [BR:mpah04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    110323225 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 OTU1_UBXL TBK1_ULD DUF2604 Motif Other DBs NCBI-GeneID:  110323225 NCBI-ProteinID:  XP_021056038 LinkDB All DBs Position 6:complement(80898290..80898699) Genome browser AA seq 126 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQVEDGHTLSDYN IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKIFCRKCYARLRPRAVNCRKKCGHTNNL RPKKVK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgacgggcaagaccatcactcttgaggtcgagcccagt gacaccatcgagaatgtcaaggccaagatccaagacaaggaaggcatcccacctgaccag cagaggctgatatttgccggcaaacaggtggaggatggccacaccctctcggactacaac atccagaaagagtccaccttgcacctggtgctgcgtctgcgcggtggcatcattgagcca tcccttcgtcagcttgcccagaagtacaactgtgacaagatattctgccgcaagtgctac gcacgcctgcgccctcgtgcagtcaactgccgcaagaagtgcggccataccaacaacctg cgccccaagaaggtcaaataa

DBGET integrated database retrieval system