KEGG   Mus pahari (shrew mouse): 110323302
Entry
110323302         CDS       T05929                                 

Gene name
Efcab7
Definition
(RefSeq) EF-hand calcium-binding domain-containing protein 7
  KO
K23852  EF-hand calcium-binding domain-containing protein 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110323302 (Efcab7)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 DnaA_N EF_assoc_2 EFhand_Ca_insen DUF1919
Other DBs
NCBI-GeneID: 110323302
NCBI-ProteinID: XP_021056107
Ensembl: MGP_PahariEiJ_G0028533
LinkDB
Position
6
AA seq 628 aa
MASNPGNDAALGTQKPLLSGSPGTKKFPLTDQEVFYMNCRAAYLTIFKSSLENILSKDQL
YLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILSKEKPTSKAELLKSFKKLDVNDDG
AILHSDLHKYLTKRGEKMTQEEVNAVLNLADINANGKFDYVKFCKLYMTTSEQCLKTTLE
RLEADSKLRRQQFGSHMEGSLERGPSPAPKPSPRVIRKNDQETSSSKGDTSHALLSTTRK
FKTSVSFTMTMSANSNRDSTLTEPNLKDWQCAQSKGCFFLEEDGEVVSHQYKMHIAQRSV
LYLTIKPLDLSQVEGKRSPWLSVDTALYILKKNENPAEPQLICFTELRNREVFGWTGELE
PGIYWLIPSTTGCRLKKETKPVTEEAQLVHRDEAGELSLTKEFRSTLSEIFEVIDLDGNG
LISLEEYNFFELRTSGEKCDEDAWAVCRENFDTKKNELTRQGFMDLHLMEANDREGDPLD
LWVTLHSMGYNKALELTEACPFVISIYAERCKPRIKAVHMEACSGQLEKAICKSVLGRSD
AKVMDGYENIIVHTCNYDTWITSIIENKSDNKVIIHINNELSKNCVNNRGLNIFAVEVAP
RSTMVCQHVMPLNEQQEWIYCCVYSLVA
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggccagcaaccctggaaatgatgcagctttgggtactcagaagccactgctttcaggg
agtcctggaacaaagaaattcccactaactgaccaggaggtattttatatgaactgtaga
gccgcctacttaactatcttcaagagcagcttggaaaacattctttctaaagatcaactt
tacctagctcttcagcatgcaggaagaaatccatcccaaaagaccattaataagtattgg
actcctcaaactgccaaactaaattttgatgatttttgtataattttaagcaaggaaaaa
cctacttcaaaagcagaattgctaaaatcatttaaaaaattagatgtaaatgatgatggc
gctattctacactctgaccttcataaatatctaacaaagagaggtgagaagatgactcag
gaagaagtgaatgctgtcctaaatttggctgatataaatgctaatggaaagtttgactat
gttaagttttgtaaattatacatgacaaccagtgagcagtgtctcaagactacactagaa
agactggaggccgacagtaaactgaggcgtcaacagtttggaagccacatggaagggtcc
cttgaaaggggtccatcaccagcaccaaaaccatcacctagggtcataagaaaaaatgac
caagaaacaagctcaagcaaaggtgacacaagccatgccttactgtcaacaactagaaag
ttcaaaacatctgtttccttcacaatgaccatgagcgctaacagtaaccgagactcaacg
ttaactgagccaaacttaaaggattggcagtgtgcacagtcaaaaggctgcttcttttta
gaagaagatggtgaagtcgtcagtcatcagtacaaaatgcacatagctcagagatctgtg
ctttacctaacaattaagccattagatctgagtcaagttgaaggaaaacgttccccctgg
ttatcggttgacacagccttatatattcttaagaaaaatgagaatccagcggagccacag
ctcatatgctttaccgaactacgaaacagagaagtgtttggatggactggtgaactagaa
ccaggaatttattggttaattccttccacaactggctgtaggctaaaaaaagaaacaaaa
ccagtaacagaagaagcccaacttgtacatagagatgaagcaggggaattatctcttaca
aaggagtttaggtcaactttatcagagatatttgaagtaattgatttagatggcaatggt
ctgattagccttgaagagtacaattttttcgaattgagaacaagtggtgagaagtgtgat
gaggacgcctgggctgtctgcagagaaaactttgacacaaagaagaatgaattaacaaga
cagggctttatggacttgcatctaatggaagcaaatgaccgagaaggagacccccttgac
ctgtgggtgactctgcattccatgggctataataaggctctggagctgacagaagcatgc
ccatttgtcatcagtatctatgctgaaagatgcaagccaagaatcaaagctgtccacatg
gaggcatgcagtgggcaacttgagaaggccatttgcaaatctgtccttggtagaagcgat
gctaaagtcatggatggctatgaaaatataattgtacatacttgcaactatgacacatgg
ataacatcaattattgaaaataagtcagataataaagtgattattcacatcaataacgaa
ctgagtaaaaactgtgtcaacaacagaggactcaacatctttgcagtagaagtggcacca
agatctacaatggtttgtcaacatgtaatgcccctgaatgaacaacaagaatggatatat
tgttgtgtgtattctcttgtagcttaa

DBGET integrated database retrieval system