Mus pahari (shrew mouse): 110323416 Help Entry 110323416         CDS       T05929                                  Name (RefSeq) interferon alpha-12-like   KO K05414   interferon alpha Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04217   Necroptosis mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04936   Alcoholic liver disease mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05320   Autoimmune thyroid disease mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110323416    04151 PI3K-Akt signaling pathway     110323416   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110323416  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110323416  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110323416    04621 NOD-like receptor signaling pathway     110323416    04622 RIG-I-like receptor signaling pathway     110323416    04623 Cytosolic DNA-sensing pathway     110323416    04650 Natural killer cell mediated cytotoxicity     110323416  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110323416   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110323416    05161 Hepatitis B     110323416    05160 Hepatitis C     110323416    05171 Coronavirus disease - COVID-19     110323416    05164 Influenza A     110323416    05162 Measles     110323416    05168 Herpes simplex virus 1 infection     110323416    05163 Human cytomegalovirus infection     110323416    05167 Kaposi sarcoma-associated herpesvirus infection     110323416    05169 Epstein-Barr virus infection     110323416    05165 Human papillomavirus infection     110323416   09171 Infectious disease: bacterial    05152 Tuberculosis     110323416   09163 Immune disease    05320 Autoimmune thyroid disease     110323416   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110323416   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110323416  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110323416 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interferons    110323416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Aip3p_Bud6_N IstB_IS21 CoV_NSP2_N Motif Other DBs NCBI-GeneID:  110323416 NCBI-ProteinID:  XP_021056286 Ensembl:  MGP_PahariEiJ_G0028481 LinkDB All DBs Position 6:complement(40574554..40575340) Genome browser AA seq 190 aa AA seqDB search MARLCAFLMVLVVLSYWSTCSLGCDLPQTHNLRNKRALTLLVKMKRLPPLSCLKDRKDFR FPQEKVDAQQIKKAQAIPVLSELTQQVLNIFTSKESSAAWNATLLDSFCNDLHQHLSDLQ GCLMQQLGMQKSPLTQEDSQMAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSFSAK LLERLSQEEE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggctaggctctgtgctttcctgatggtcctggtggtgttgagctactggtcaacctgc tctctaggatgtgaccttcctcaaactcataacctcaggaacaaaagagctttgacactc ctggtaaaaatgaagagactcccccctctctcctgcctgaaggacagaaaggactttaga ttcccccaggagaaggtggatgcccagcagatcaagaaggctcaagccatccctgtcctg agtgaactgacccagcaggtcctgaacatcttcacatcaaaggagtcatctgctgcttgg aatgcaaccctcctagactcattctgcaatgacctccaccagcatctcagtgacctgcaa ggctgtctgatgcagcagctgggaatgcagaaaagtcccctgacccaggaagactcccag atggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtctttctcagccaag ttgctggaaagactgagtcaggaggaggaatga

DBGET integrated database retrieval system