Mus pahari (shrew mouse): 110323466 Help Entry 110323466         CDS       T05929                                  Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04621   NOD-like receptor signaling pathway mpah05012   Parkinson disease mpah05132   Salmonella infection mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110323466  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110323466   09164 Neurodegenerative disease    05012 Parkinson disease     110323466   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110323466  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mpah03110]     110323466 Chaperones and folding catalysts [BR:mpah03110]  Protein folding catalysts   Protein disulfide isomerase    110323466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 AhpC-TSA OST3_OST6 Thioredoxin_7 Glutaredoxin Thioredoxin_9 Motif Other DBs NCBI-GeneID:  110323466 NCBI-ProteinID:  XP_021056357 Ensembl:  MGP_PahariEiJ_G0028386 LinkDB All DBs Position 6:complement(11887606..11900742) Genome browser AA seq 105 aa AA seqDB search MVKLIESKEAFQEALIAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagctgatcgagagcaaggaagcgtttcaggaggccctgatcgctgcgggagac aagcttgtcgtagtggacttctctgctacgtggtgtggaccttgcaaaatgatcaagccc ttcttccattccctctgtgacaagtattccaatgtggtgttccttgaagtggacgtggat gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttttat aaaaagggtcaaaaggtgggggaattctccggtgctaacaaggaaaagcttgaagcctct attactgaatatgcctaa

DBGET integrated database retrieval system