KEGG   Mus pahari (shrew mouse): 110324269
Entry
110324269         CDS       T05929                                 

Gene name
Psen1
Definition
(RefSeq) presenilin-1 isoform X1
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04330  Notch signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110324269 (Psen1)
   04330 Notch signaling pathway
    110324269 (Psen1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110324269 (Psen1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110324269 (Psen1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110324269 (Psen1)
   05022 Pathways of neurodegeneration - multiple diseases
    110324269 (Psen1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110324269 (Psen1)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     110324269 (Psen1)
Peptidases and inhibitors [BR:mpah01002]
 Aspartic peptidases
  Family A22: presenilin family
   110324269 (Psen1)
SSDB
Motif
Pfam: Presenilin LRRC37AB_C
Other DBs
NCBI-GeneID: 110324269
NCBI-ProteinID: XP_021057350
Ensembl: MGP_PahariEiJ_G0029678
LinkDB
Position
7
AA seq 467 aa
MTEIPAPLSYFQNAQMSEDSHSSSAVRSQNDSQERQQHHDRQRLDNPEPISNGRPQSNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYVTVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVPKNPKYNTQRAERETQDSGSGNDDGGFSEEWEAQRDSHLGPHRSTPESRAA
AQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgacagagatacccgcacctttgtcctacttccagaatgcacagatgtctgaggacagc
cactccagcagcgccgtccggagccagaatgacagccaagaacggcagcagcatcacgac
aggcagagacttgacaaccctgagccaatatctaatggccggccccagagtaactcaagg
caggtggtggagcaagatgaggaggaagacgaagagctgacattgaaatatggagccaag
catgtcatcatgctctttgtccccgtgaccctgtgcatggttgtcgtcgtggccaccatc
aaatcagtcagcttctatacccggaaggacgggcagctgatctacaccccattcacagaa
gacaccgagactgtaggacaaagagccctgcactcgatcctgaatgctgccatcatgatc
agtgtcattgtcgttatgaccatcctcctggtggttctgtataaatacaggtgctacaag
gtcatccatgcctggcttattatttcatctctgttgttgctgttctttttttcattcatt
tacttaggggaagtatttaagacctacaatgttgccgtggactacgttacagtagcgctc
ctgatctggaattttggtgtggtcgggatgatcgccattcactggaaaggcccccttcga
ctgcagcaggcgtatctcattatgatcagtgccctcatggccctggtatttatcaagtac
ctccctgaatggaccgcatggctcatcttggctgtgatttcagtatatgatttggtggct
gttttgtgccccaaaggcccacttcgtatgctggttgaaacagcccaggaaagaaatgag
actctctttccagctcttatctattcctcaacaatggtgtggttggtgaatatggctgaa
ggagacccagaagcccaaaggagggtacccaaaaaccccaagtataacacacaaagagcg
gaaagggagacacaggacagtggttctgggaacgatgatggtggcttcagtgaggagtgg
gaagcccaaagagacagtcacctggggcctcatcgctccactcccgagtcaagagctgct
gcccaggaactttctgggagcattctaacgagtgaagacccggaggaacgaggagtaaaa
cttggactgggagatttcattttctacagtgttctggttggtaaggcctcagcaaccgcc
agtggggactggaacacaaccatagcctgctttgtagccatactgatcggcctgtgcctt
acgttacttctgctcgccattttcaagaaagcgttgccagccctccccatctccatcacc
ttcgggctcgtgttctacttcgccacagattaccttgtgcagcccttcatggaccaactt
gcattccaccagttttatatctag

DBGET integrated database retrieval system