KEGG   Mus pahari (shrew mouse): 110324364
Entry
110324364         CDS       T05929                                 

Gene name
Mpp5
Definition
(RefSeq) MAGUK p55 subfamily member 5
  KO
K06091  MAGUK p55 subfamily member 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110324364 (Mpp5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110324364 (Mpp5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110324364 (Mpp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mpah04990]
    110324364 (Mpp5)
Domain-containing proteins not elsewhere classified [BR:mpah04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   110324364 (Mpp5)
SSDB
Motif
Pfam: Guanylate_kin L27_N PDZ SH3_2 PDZ_6 L27 SH3_1 PDZ_2 SH3_9
Other DBs
NCBI-GeneID: 110324364
NCBI-ProteinID: XP_021057529
Ensembl: MGP_PahariEiJ_G0029635
LinkDB
Position
7
AA seq 675 aa
MTTSYMNGHVTEESDSGIKNLDLASPEEYPKHREMAVDCPGDLGTRMMPVRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVK
ILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVTVHMNKASPPF
PLIANVQDLVQEVQTVLKPVHQKEGQELTALLSAPHIQALLLAHDKVAEQEMQLEPITDE
RVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgacaacatcatatatgaatgggcatgtaacagaggaatcagacagcggaataaaaaat
cttgatcttgcatcaccagaggaatatccgaagcatcgagagatggctgttgactgccct
ggagatttgggcaccagaatgatgccagtacgaagaagtgcacagttagagcgcattcga
caacaacaggaggatatgagacgtaggcgcgaagaggaagggaaaaagcaagaacttgac
ctaaattcttccatgagacttaagaaactagctcaaattcctccaaagactggaatagat
aaccctatatttgacacagaagaaggaattgttttagaaagtcctcactatgctgtgaaa
atattagaagttgaagacttgttctcttcacttaaacacatccaacacactttggttgat
tctcagagccaggaggacatttcactgcttttacagcttgtacaaaacagagattttcag
aatgcgttcaagatacacaatgctgtcacagtgcacatgaacaaggccagccctccgttt
cctcttatcgccaatgtacaagaccttgtacaagaggtacaaactgtcttaaagccagtc
catcagaaggaaggacaagaattaaccgctttgttgagtgctccacatattcaggcactt
ttactagcccatgataaggttgctgagcaggaaatgcagctagagcccattacagatgag
agagtctatgaaagtatcggccattacgggggagaaactgtaaaaatagttcgtatagaa
aaagctcgggatattccattgggtgccacagttcgtaatgaaatggattctgtcatcata
agccggatagtgaaaggaggcgctgcagagaagagtggcctcctgcacgaaggagacgaa
gttctggagatcaatggcattgaaatccggggcaaagatgtcaatgaggtttttgacttg
ttgtctgatatgcatggtacgttgacatttgttctgattcctagtcaacagatcaagcca
cctcctgccaaagaaactgtaatccatgtgaaagctcattttgactatgacccctcagat
gatccttatgttccatgtcgagagttagggctgtcttttcaaaaaggagatatacttcat
gtgatcagtcaagaagatccaaattggtggcaggcctatagagagggagatgaagataat
cagcctctagctggacttgttccaggcaaaagctttcagcagcaaagggaagccatgaag
caaactatagaagaagataaggagccagagaaatcaggaaaactgtggtgtgcgaagaag
aataaaaagaagaggaaaaaggttttatataacgccaataaaaatgacgattatgacaat
gaagagatcttaacgtatgaggaaatgtcactttaccaccagccagcaaataggaaaaga
cctatcatcttgattggtccacagaactgtggccagaatgaactgcgccagagactaatg
aacaaagaaaaagaccgctttgcatctgctgttcctcatacaactcggaataggcgagac
catgaagtagctgggagagattaccactttgtttcacggcaagcattcgaagcagacata
gcagctggcaagttcattgaacatggtgaatttgagaaaaatctgtatggaaccagcata
gattctgtacgacaagtaatcaactctggcaaaatatgtcttttaagtctacgaacacag
tccttgaagaccctccgaaattcagatttgaaaccatatatcatcttcattgcaccacct
tcacaagagagacttcgggcattgttagccaaggaaggcaagaacccaaagcctgaagaa
ttaagggagatcattgagaaaacgagagagatggagcagaacaatggccactacttcgac
actgcaattgtgaattcagatcttgataaagcctatcaggaattgcttaggctcattaac
aaactggatactgaacctcagtgggtgccatctacctggctaaggtga

DBGET integrated database retrieval system