Mus pahari (shrew mouse): 110324484 Help Entry 110324484         CDS       T05929                                  Symbol Nfkbia Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mpah  Mus pahari (shrew mouse) Pathway mpah04024   cAMP signaling pathway mpah04062   Chemokine signaling pathway mpah04064   NF-kappa B signaling pathway mpah04210   Apoptosis mpah04380   Osteoclast differentiation mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04625   C-type lectin receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04668   TNF signaling pathway mpah04722   Neurotrophin signaling pathway mpah04920   Adipocytokine signaling pathway mpah04926   Relaxin signaling pathway mpah04931   Insulin resistance mpah04936   Alcoholic liver disease mpah05132   Salmonella infection mpah05134   Legionellosis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05145   Toxoplasmosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05208   Chemical carcinogenesis - reactive oxygen species mpah05215   Prostate cancer mpah05220   Chronic myeloid leukemia mpah05222   Small cell lung cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     110324484 (Nfkbia)    04668 TNF signaling pathway     110324484 (Nfkbia)    04024 cAMP signaling pathway     110324484 (Nfkbia)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110324484 (Nfkbia)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110324484 (Nfkbia)    04621 NOD-like receptor signaling pathway     110324484 (Nfkbia)    04622 RIG-I-like receptor signaling pathway     110324484 (Nfkbia)    04623 Cytosolic DNA-sensing pathway     110324484 (Nfkbia)    04625 C-type lectin receptor signaling pathway     110324484 (Nfkbia)    04660 T cell receptor signaling pathway     110324484 (Nfkbia)    04658 Th1 and Th2 cell differentiation     110324484 (Nfkbia)    04659 Th17 cell differentiation     110324484 (Nfkbia)    04657 IL-17 signaling pathway     110324484 (Nfkbia)    04662 B cell receptor signaling pathway     110324484 (Nfkbia)    04062 Chemokine signaling pathway     110324484 (Nfkbia)   09152 Endocrine system    04920 Adipocytokine signaling pathway     110324484 (Nfkbia)    04926 Relaxin signaling pathway     110324484 (Nfkbia)   09156 Nervous system    04722 Neurotrophin signaling pathway     110324484 (Nfkbia)   09158 Development and regeneration    04380 Osteoclast differentiation     110324484 (Nfkbia)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110324484 (Nfkbia)    05208 Chemical carcinogenesis - reactive oxygen species     110324484 (Nfkbia)    05203 Viral carcinogenesis     110324484 (Nfkbia)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110324484 (Nfkbia)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     110324484 (Nfkbia)    05215 Prostate cancer     110324484 (Nfkbia)    05222 Small cell lung cancer     110324484 (Nfkbia)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110324484 (Nfkbia)    05170 Human immunodeficiency virus 1 infection     110324484 (Nfkbia)    05161 Hepatitis B     110324484 (Nfkbia)    05160 Hepatitis C     110324484 (Nfkbia)    05171 Coronavirus disease - COVID-19     110324484 (Nfkbia)    05164 Influenza A     110324484 (Nfkbia)    05162 Measles     110324484 (Nfkbia)    05168 Herpes simplex virus 1 infection     110324484 (Nfkbia)    05163 Human cytomegalovirus infection     110324484 (Nfkbia)    05167 Kaposi sarcoma-associated herpesvirus infection     110324484 (Nfkbia)    05169 Epstein-Barr virus infection     110324484 (Nfkbia)   09171 Infectious disease: bacterial    05132 Salmonella infection     110324484 (Nfkbia)    05135 Yersinia infection     110324484 (Nfkbia)    05134 Legionellosis     110324484 (Nfkbia)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110324484 (Nfkbia)    05140 Leishmaniasis     110324484 (Nfkbia)    05142 Chagas disease     110324484 (Nfkbia)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110324484 (Nfkbia)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110324484 (Nfkbia)    04931 Insulin resistance     110324484 (Nfkbia)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpah03000]     110324484 (Nfkbia)    04131 Membrane trafficking [BR:mpah04131]     110324484 (Nfkbia) Transcription factors [BR:mpah03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     110324484 (Nfkbia) Membrane trafficking [BR:mpah04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     110324484 (Nfkbia) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  110324484 NCBI-ProteinID:  XP_021057758 Ensembl:  MGP_PahariEiJ_G0029516 LinkDB All DBs Position 7:complement(52311007..52314192) Genome browser AA seq 314 aa AA seqDB search MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP LAAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVI TNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATN YNGHTCLHLASIHGYLAIVELLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccagctgggcacggccaggactgggccatggagggcccgcgggacggcctc aagaaggagcgcttggtggacgatcgccacgacagcggtctggactccatgaaggacgag gaatacgagcaaatggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgccg ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gcaatcatccacgaagagaagactctgaccatggaggtgattggtcaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccaggaattgctgaagcacttctgaaagctggctgtgatcctgagcttcga gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta gcagtcttgacgcagacctgcacgccccagcatctccactccgtcctgcaggccaccaac tacaatggccacacgtgtctgcacctagcctctatccatggctacctggccatcgtggag ctcttggtgactttgggtgctgatgtcaatgctcaggagccctgcaatggccggacagcc ctccaccttgcggtggacctgcagaaccctgacctggtctcgctcttgttgaagtgcggg gccgatgtcaacagggtaacctaccaaggttactccccctaccagcttacctggggccgc ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatctccagatgctg ccggagagtgaggatgaggagagctatgacacggagtcagaattcacagaggacgagctg ccctatgatgactgtgtgtttggaggccaacgtctgacattataa

DBGET integrated database retrieval system