Mus pahari (shrew mouse): 110324536 Help Entry 110324536         CDS       T05929                                  Symbol Pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism mpah  Mus pahari (shrew mouse) Pathway mpah03030   DNA replication mpah03410   Base excision repair mpah03420   Nucleotide excision repair mpah03430   Mismatch repair mpah03440   Homologous recombination Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     110324536 (Pold4)    03410 Base excision repair     110324536 (Pold4)    03420 Nucleotide excision repair     110324536 (Pold4)    03430 Mismatch repair     110324536 (Pold4)    03440 Homologous recombination     110324536 (Pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mpah03032]     110324536 (Pold4)    03400 DNA repair and recombination proteins [BR:mpah03400]     110324536 (Pold4) DNA replication proteins [BR:mpah03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     110324536 (Pold4) DNA repair and recombination proteins [BR:mpah03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       110324536 (Pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      110324536 (Pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  110324536 NCBI-ProteinID:  XP_021057846 Ensembl:  MGP_PahariEiJ_G0013997 LinkDB All DBs Position 1:115633260..115635005 Genome browser AA seq 107 aa AA seqDB search MGRKRFITDSYPVVKKRERPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP CTGITRLQRWCRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggagaggccc cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct tgtacaggtatcacaaggctgcagcgctggtgtcgggcagagcagatgggcttgaagccc cccctagaagtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc ctctggcatctctacccactctga

DBGET integrated database retrieval system