Mus pahari (shrew mouse): 110324554 Help Entry 110324554         CDS       T05929                                  Symbol Arf6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04014   Ras signaling pathway mpah04072   Phospholipase D signaling pathway mpah04144   Endocytosis mpah04517   IgSF CAM signaling mpah04666   Fc gamma R-mediated phagocytosis mpah05132   Salmonella infection mpah05135   Yersinia infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110324554 (Arf6)    04072 Phospholipase D signaling pathway     110324554 (Arf6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110324554 (Arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110324554 (Arf6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     110324554 (Arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110324554 (Arf6)    05135 Yersinia infection     110324554 (Arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110324554 (Arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110324554 (Arf6)    04031 GTP-binding proteins [BR:mpah04031]     110324554 (Arf6) Membrane trafficking [BR:mpah04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     110324554 (Arf6)   Arf GTPases and associated proteins    Arf GTPases     110324554 (Arf6) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110324554 (Arf6)   Exosomal proteins of colorectal cancer cells    110324554 (Arf6) GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     110324554 (Arf6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  110324554 NCBI-ProteinID:  XP_021057868 Ensembl:  MGP_PahariEiJ_G0029562 LinkDB All DBs Position 7:64892580..64896411 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgctgggc ctggacgcagccggcaagaccacgatcctgtacaagttgaagctgggccagtccgtgacc accatccccacggtgggcttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtggtagactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctccggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system