KEGG   Mus pahari (shrew mouse): 110324782
Entry
110324782         CDS       T05929                                 
Symbol
Nrcam
Name
(RefSeq) neuronal cell adhesion molecule isoform X1
  KO
K06756  neuronal cell adhesion molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110324782 (Nrcam)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY C2-set_2 Ig_C17orf99 Pur_ac_phosph_N Ig_5 Ig_4 SIT fn3_2 INCA1
Other DBs
NCBI-GeneID: 110324782
NCBI-ProteinID: XP_021058134
Ensembl: MGP_PahariEiJ_G0029483
LinkDB
Position
7:42118428..42384660
AA seq 1310 aa
MQLKIMPKKKQKHLSAGGVPLILFLCQMISALDVPLDPKLLHDLVQPPTITHQSPKDYII
DPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAETYE
GVYQCTARNERGAAVSNNIVVRPSRSPLWTKERLEPIILRNGQSLVLPCRPPIGLPPAII
FWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISLKV
ISVDELNDTIAANLSDTEFYGAKSSKERPPTFLTPEGNESHKEELRGNVLSLECIAEGLP
TPIIYWIKEDGTLPANRTFYRNFKKTLQITHVSEADSGNYQCIAKNALGAVHHTISVTVK
AAPYWIVAPQNLVLSPGENGTLICRANGNPKPRISWLTNGVPIEIALDDPSRKIDGDTII
FSNVQESSSAVYQCNASNKYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAF
FGSPMPAIEWFKGTKGSALHEDIYVLHDNGTLEIPVAQKDSTGTYTCVARNKLGMAKNEV
HLEIKDPTRIIKQPEYAVVQRGSKVSFECRVKHDHTLIPTIMWLKDNGELPNDERFSTDK
DHLVVSDVKDDDGGTYTCTANTTLDSASASALLRVVAPTPTPAPIYDVPNPPFDLELTNQ
LDKSVQLTWTPGDDNNSPITKFIIEYEDAMHDAGLWHHQAEVSGTQTTAQLKLSPYVNYS
FRVMAENSIGRSMPSEASEQYLTKAAEPDQNPTAVEGLGTEPDNLVITWKPLNGFQSNGP
GLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVGFAPEPAAVMG
HSGEDLPMVAPGNVHVNVVNSTLAEVHWDPVPPKSVRGHLQGYRIYYWKTQSSSKRNRRH
IEKKILTFQGTKTHGMLPGLQPYSHYALNVRVVNGKGEGPASTDRGFHTPEGVPSAPSSL
KIVNPTLDSLTLEWDPPSHPNGILTEYILKYQPINSTHELGPLVDLKIPANKTRWTLKNL
NFSTRYKFYFYAQTSVGSGSQITEEAITTVDEAGIPPPDVGAGKVRAVNPRISNVTAAAA
ETYANISWEYEGPEHVKFYVEYGVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGA
EGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKY
PVKEKEDAHADPEIQPMKEDDGTFGEYRSFESDAEDHKPLKKGSRTPSDRTVKKEDSDDS
LVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSLV
NT seq 3933 nt   +upstreamnt  +downstreamnt
atgcagcttaaaataatgccgaagaagaagcagaagcacttatctgcaggcggagtgccc
ctgattctcttcctgtgccagatgatcagcgctctggacgttcctcttgatccaaagctc
cttcatgacttggtacaacctccaaccatcactcatcagtcacccaaagactacatcatt
gaccctcgggagaatattgtaatccagtgtgaggccaaagggaaacctcccccaagcttt
tcctggactcgtaatggaacacattttgacatagacaaggaccctctggtcaccatgaag
cctggctcaggaacccttgtcatcaacatcatgagtgaggggaaagcagagacctatgaa
ggagtctatcagtgcaccgcgaggaacgagcgaggagctgctgtctccaataacatcgtt
gtccgcccgtccaggtcgcccttgtggaccaaggaacgacttgaaccgataatactccgg
aatggtcagtcattagtgctaccatgtaggcctccaattggattacctccggccataata
ttttggatggataattccttccagagacttccacagagtgagcgggtctcccaaggccta
aatggggacctttacttctccaatgtcctcccagaggacacccgtgaagactatatctgc
tatgccagatttaatcacactcaaaccatccaacagaagcagcccatttctttgaaggtg
atttcagtggatgaattgaatgacactatagctgctaatttgagtgacactgagttttat
ggtgctaaatctagtaaagagaggcccccaacgtttctaactccagagggcaatgaaagc
cacaaagaggaattaagaggaaacgtgctttcgctggagtgcattgcggaaggcctacct
actccaattatttactggatcaaagaagacggaacgcttcctgccaaccggacgttttat
cggaactttaagaaaaccttgcagatcactcatgtttccgaagcagactctggaaattat
cagtgcatagcaaaaaatgcattaggagccgtccatcacaccatttctgtcaccgttaaa
gcggcaccctactggatcgtggcacctcaaaacctcgtgctttccccgggagagaatggg
accctcatctgcagagctaatggcaacccgaaacccagaattagctggttaacaaatgga
gtcccgatagaaattgctcttgatgaccccagcagaaaaatagatggcgataccattata
ttttcaaatgttcaagaaagctcaagtgcagtttatcagtgcaatgcttctaacaaatat
ggatatttactagcaaatgcatttgtaaatgttctcgctgaaccacctcggattcttaca
ccggcaaacacactgtaccaggtcattgcaaacaggcctgctttgctagactgtgccttc
tttgggtctcctatgcctgccattgagtggtttaaagggacgaagggaagcgctcttcat
gaagacatttatgttttacatgataatggaacgttagaaattcctgtggcccaaaaggat
agtacagggacgtatacttgtgtcgcaaggaataaattaggaatggcaaagaatgaagtt
cacttggaaatcaaagatccaaccaggatcattaaacaacctgaatatgcagtcgtccag
agggggagcaaggtgtcctttgaatgcagagtgaaacatgaccacaccttaatccccacc
attatgtggctgaaggacaatggagagctgcccaatgatgaaaggttctccactgacaag
gatcatctggtggtatctgatgtaaaggatgacgatggtggcacctacacatgtacagcc
aacacaacgctggacagtgcttcagccagtgctctgctcagggttgtcgctcctactcca
actccagcccccatttacgatgtcccgaatcctccctttgatttagaattgaccaatcaa
cttgacaaaagtgttcagctgacatggaccccaggcgatgacaacaatagccccattaca
aaattcatcattgagtatgaagatgcaatgcatgacgcagggctgtggcaccaccaggct
gaagtttctggaacgcagaccacagcccaactgaagctgtctccctatgtgaactactcc
ttccgtgtcatggcagagaacagcattgggagaagtatgccgagcgaggcatcagagcag
tatcttacaaaagccgcagaaccagatcagaaccccacggctgtggaaggattagggaca
gagccagacaacttggtgattacatggaagcccctgaatggttttcaatcgaatgggccc
ggcctccagtacaaagtgagctggcgccagaaagatggtgacgatgagtggacgtctgtg
gttgtggccaatgtgtccaaatacattgtttctggcacaccaacctttgtcccatacctg
ataaaagttcaagctctgaatgatgtggggtttgctccagagccagctgcagtcatgggg
cattctggagaagaccttccaatggtggctcctggaaatgtacatgtcaacgtggtgaac
agtacgttggcagaggtgcactgggaccctgttcctcccaagagtgtccgaggacactta
caagggtaccggatttactactggaagactcagagctcctctaaaagaaacaggcgccac
attgagaagaagatcctcaccttccagggcaccaagacgcacggcatgctgccagggcta
caaccatacagtcactatgctctcaacgtccgagtggtcaatgggaaaggggagggccca
gccagcacggacagaggcttccatacaccagagggagtccccagtgctccctcatctttg
aaaattgttaatcctacactggactctctcactttggaatgggacccgccaagccaccca
aatggcatcctaactgagtacatcttaaaatatcaaccaattaatagcacacacgagcta
ggccctctggtagatttaaaaattcctgccaacaagacccgctggactttgaaaaattta
aatttcagcactcggtacaagttctatttctatgcacagacatcagtggggtcaggcagt
cagatcacagaggaagccataacaactgtggacgaagctggtattcctccacctgatgta
ggtgcaggcaaagtccgtgcagtaaatcccaggatcagcaatgtcactgctgcagctgct
gagacgtatgccaatatcagttgggagtatgagggaccagagcatgtgaagttttatgtt
gaatatggtgtagcaggcagcaaagaagaatggaggaaagaaattgtaaatggttctcgg
agcttctttgggttaaagggtctaatgccaggaacagcatacaaagttcgagttggtgct
gagggggactctggttttgtgagttcagaggatgtgtttgagacaggaccagcaatggca
agccggcaagtggatattgcaacccaaggctggttcataggtctaatgtgcgccgttgcc
ctcctcatcttaattttgctgattgtttgtttcatcagaagaaacaagggtggtaaatac
ccagttaaagaaaaggaggatgctcatgcagaccctgaaatccagcccatgaaggaagat
gatgggacgtttggagaatacaggtcttttgaaagtgatgcagaagatcacaagcctttg
aaaaaaggaagtcgaacaccttcagacaggactgtgaaaaaagaagatagtgacgatagc
ctggttgactacggagagggggtgaacggccaattcaacgaggatggctcctttattgga
caatacagtggtaagaaagagaaagagccagcagaggggaatgaaagctcagaggcccct
tctcctgtcaacgcaatgaactccttggtttaa

DBGET integrated database retrieval system