KEGG   Mus pahari (shrew mouse): 110324828
Entry
110324828         CDS       T05929                                 
Symbol
Serpina5
Name
(RefSeq) plasma serine protease inhibitor
  KO
K03913  protein C inhibitor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110324828 (Serpina5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110324828 (Serpina5)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110324828 (Serpina5)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I4: serpin family
   110324828 (Serpina5)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110324828 (Serpina5)
SSDB
Motif
Pfam: Serpin DUF4804
Other DBs
NCBI-GeneID: 110324828
NCBI-ProteinID: XP_021058195
Ensembl: MGP_PahariEiJ_G0029828
LinkDB
Position
7:98106991..98112003
AA seq 406 aa
MRFCPILCLVLFFSHGVASRQRSRSKEKKKAKESSVGAVGTPSSKDFAFRLYRALASEAP
GQNVFFSPMSVSMCLGMLSLGAGLKTKTQILDGLGLSLQQGQEDKFHKGFQQLLQRIREP
SDSLQLSLGSALFKDPAVHIRDDFLSAMKTLYMSDTFSTNFGNPESAKKQINDYVAKQTK
GKIVDLIKDLDSTHVMMVVNYIFFKAKWQTAFSVTNTRQMDFHVTPKKTIQVPMMNREDG
YSYYLDKNISCTVVGIPYQGNAIALFILPSEGKMKQVEDGLDERTLRNWLKMFTKRHLDL
YLPKFSIEGTYKLEKILPKLGIQDVFTTHANLSGMTDHTNIKLSEMVHKSMMEVEESGTT
AAATTGAIFTFRSARLSSLKIEFTRPFLMFIMEDSHMILAAKVTKP
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaggttctgccccattctgtgcctggtgctgttcttcagccatggggtggcttcccgc
caacgctcccgttccaaggagaagaagaaggctaaagagtcctcggtgggtgctgtggga
actcccagcagcaaagactttgccttcagactctacagggccttggcttctgaagctcct
ggtcagaatgttttcttctcccccatgagtgtgtctatgtgcctgggcatgctctccctg
ggggctggcttgaagacgaagacacagatcctggatggcctaggcctcagcctccagcaa
ggccaagaggacaagttccacaagggcttccaacagctgctacagaggatcagggagcct
agtgacagcctccagctgagcctgggcagtgccctttttaaagacccagcagtgcatatc
cgggacgacttcctgagtgccatgaagacgctgtacatgtcagacacgttctctaccaac
tttgggaaccctgaaagcgccaagaagcagatcaatgactatgtagccaagcagaccaag
ggcaagattgtagacttgatcaaggatctcgacagtacacatgtcatgatggtggtaaat
tacatcttcttcaaagccaagtggcagacagccttcagtgtgacaaacacccgccagatg
gatttccatgtgacccccaagaagaccatacaggtgcccatgatgaaccgtgaagatggg
tattcctactacctggacaaaaacatctcctgcacggtggtggggatcccttatcaaggc
aatgccatcgctctatttattctccccagcgagggcaagatgaagcaggtagaggatggt
ctggacgagagaacattgaggaactggctcaagatgttcaccaagagacatttagatctt
tacctccccaagttctccattgagggtacctacaaactggaaaagatcctccccaagctg
ggcatccaggatgtcttcaccacccatgctaacttgtctggcatgactgaccacaccaat
atcaagttgtctgagatggtgcacaaatccatgatggaggtggaagagtcgggaaccaca
gccgctgccaccacaggagccatcttcacattcagatctgctcggctgagctctctgaag
atagaattcaccagaccctttctgatgttcattatggaggattcacatatgattttggct
gccaaggtgaccaagccctga

DBGET integrated database retrieval system