Mus pahari (shrew mouse): 110325235 Help Entry 110325235         CDS       T05929                                  Name (RefSeq) tubulin alpha chain-like   KO K07374   tubulin alpha Organism mpah  Mus pahari (shrew mouse) Pathway mpah04145   Phagosome mpah04210   Apoptosis mpah04530   Tight junction mpah04540   Gap junction mpah04814   Motor proteins mpah05010   Alzheimer disease mpah05012   Parkinson disease mpah05014   Amyotrophic lateral sclerosis mpah05016   Huntington disease mpah05020   Prion disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     110325235   09143 Cell growth and death    04210 Apoptosis     110325235   09144 Cellular community - eukaryotes    04530 Tight junction     110325235    04540 Gap junction     110325235   09142 Cell motility    04814 Motor proteins     110325235  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110325235   09164 Neurodegenerative disease    05010 Alzheimer disease     110325235    05012 Parkinson disease     110325235    05014 Amyotrophic lateral sclerosis     110325235    05016 Huntington disease     110325235    05020 Prion disease     110325235    05022 Pathways of neurodegeneration - multiple diseases     110325235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mpah03019]     110325235    03036 Chromosome and associated proteins [BR:mpah03036]     110325235   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110325235    04147 Exosome [BR:mpah04147]     110325235 Messenger RNA biogenesis [BR:mpah03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      110325235 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      110325235 Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     110325235 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110325235   Exosomal proteins of other body fluids (saliva and urine)    110325235   Exosomal proteins of colorectal cancer cells    110325235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tubulin_C DUF7281 Motif Other DBs NCBI-GeneID:  110325235 NCBI-ProteinID:  XP_021058712 LinkDB All DBs Position 8:100903413..100904216 Genome browser AA seq 248 aa AA seqDB search MVDNEAIYDICLRNLDIACPTYTNLNRLIGQIVSSITASLRFDGTLNVDLTEFQTNLVPY PRIHFPLATYAQVISAEKAYHAQLSVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGD VVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTT AITEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAGEDLAAPEKDYEEVGVDSVEA EAEEGEEY NT seq 747 nt NT seq  +upstreamnt  +downstreamnt atggtggataacgaagccatctacgacatctgcctcaggaacctggatattgcgtgcccc acatacaccaacctcaatcgtctgattgggcagattgtgtcgtccatcacagcctccctg aggtttgatggcaccctgaatgtggacctaacagaattccagaccaacctggtgccctac cctcgcatccacttcccactggcgacctatgcccaggtcatctctgctgagaaggcatac catgcgcagctgtcagtggcagagatcaccaacgcctgcttcgagccagccaatcagatg gttaagtgtgaccctcgccgcggcaaatacatggcctgctgcatgttgtaccggggggat gtggttcccaaagatgtcaacgcggctattgccaccatcaagacaaagcgcaccatccag tttgtagattggtgcccaactggatttaaggtgggtattaattaccagcctcccaccgtg gtccctgggggagacctggccaaggtacagcgggccgtgtgcatgctgagcaataccacg gccatcacagaggcctgggcccgcctggatcacaaatttgacctcatgtatgccaagcgg gcctttgtgcattggtatgtgggagaaggtatggaggaaggagagttctcagaggccggg gaagacctagcagcaccggagaaggattatgaagaggtgggcgtggattccgtggaagca gaggcagaagaaggggaggagtactga

DBGET integrated database retrieval system