KEGG   Mus pahari (shrew mouse): 110325338
Entry
110325338         CDS       T05929                                 
Symbol
Ednrb
Name
(RefSeq) endothelin B receptor
  KO
K04198  endothelin receptor type B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04916  Melanogenesis
mpah04926  Relaxin signaling pathway
mpah05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110325338 (Ednrb)
   04022 cGMP-PKG signaling pathway
    110325338 (Ednrb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110325338 (Ednrb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110325338 (Ednrb)
   04916 Melanogenesis
    110325338 (Ednrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325338 (Ednrb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mpah04030]
    110325338 (Ednrb)
G protein-coupled receptors [BR:mpah04030]
 Rhodopsin family
  Peptide
   Endothelin
    110325338 (Ednrb)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4 DUF2070
Other DBs
NCBI-GeneID: 110325338
NCBI-ProteinID: XP_021058941
Ensembl: MGP_PahariEiJ_G0030594
LinkDB
Position
8:complement(92148545..92180303)
AA seq 442 aa
MQSPTSRCGRALVALLLACGFLGVWGEKRGFPPAQATPSLLGTKEVMTPPTKTSWTRSFN
SSLMRSSAPAEVTKGGRVAGVPPRSFPPPCQRNIEISKTFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DMITSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAVFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYDQSNPHRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQTFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcaatcgcccacaagccggtgcggacgcgccttggtggcgctgctgctggcctgtggc
ttcttgggggtatggggagagaaaagaggattcccacctgcccaagccacgccgtctctt
ctcgggactaaagaggtaatgacgccacccactaagacgtcctggaccagaagtttcaac
tccagtctgatgcgttcctccgcacctgcggaggtgaccaaaggaggtagagtggctgga
gtcccgccaagatccttccctcctccgtgccaacgaaatatcgagatcagcaagactttt
aaatacatcaacacggttgtgtcatgcctcgtgttcgtgctaggcatcatcgggaactcc
acgctgctaagaatcatctacaagaacaagtgcatgcgcaatggtcccaatatcttgatc
gccagtctggctctgggagacctgctgcacatcatcatcgacattcccattaacacctac
aagttgctcgcagaggactggccgtttggagctgagatgtgtaagctggtgcccttcata
cagaaggcttctgtggggatcacggttctgagtctgtgtgctctaagtattgacagatat
cgagctgttgcttcttggagtcgaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttaatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatatgattacgtcggactacaaaggaaagcccctaagggtctgcatgcttaatcccttt
cagaaaacagccttcatgcagttttacaagacagccaaagattggtggctgttcagtttc
tacttctgcttgcccttagccatcactgcagtcttttataccctgatgacctgtgaaatg
ctcaggaagaagagtggaatgcagattgctttgaatgatcacttaaagcagagacgagaa
gtggccaagacagttttctgcctagtcctcgtgtttgctctctgttggcttccccttcac
ctcagcaggattctgaagctcaccctgtatgaccagagcaatcctcacaggtgtgagctt
ctgagctttttgttggttttggactacattggtatcaacatggcttctttgaattcctgc
atcaatccaatcgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgt
ttgtgctgctggtgccaaacgtttgaggaaaagcagtccttggaggagaagcagtcttgc
ttgaagttcaaagccaacgatcacggatatgacaacttccggtccagcaataaatacagc
tcatcttga

DBGET integrated database retrieval system