KEGG   Mus pahari (shrew mouse): 110325498
Entry
110325498         CDS       T05929                                 
Symbol
Clu
Name
(RefSeq) clusterin
  KO
K17252  clusterin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110325498 (Clu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110325498 (Clu)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110325498 (Clu)
Chaperones and folding catalysts [BR:mpah03110]
 Other chaperones and cochaperones
  Others
   110325498 (Clu)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110325498 (Clu)
SSDB
Motif
Pfam: Clusterin YlqD YqzH Gasdermin_C
Other DBs
NCBI-GeneID: 110325498
NCBI-ProteinID: XP_021059186
Ensembl: MGP_PahariEiJ_G0030450
LinkDB
Position
8:56936522..56949718
AA seq 448 aa
MKILLLGVALLLTWDHGMVLGGQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKSLIE
KTNAERKSLLNSLEEAKKRKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTC
MKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFA
RASGIIDTLFQDRFFTHEPRDPHYFSPIGFPHKRPHFLYPKSRLVRSLMPPSYYGPPSFH
TMFQPFFDMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQ
CEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLHSFQSKMLNTSSLLEQ
LNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPE
EVSKDNPKFMDTVAEKALQEYRRKSRAE
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaagattctcctgctgggcgtggcactgctgctgacctgggaccatggcatggtcctg
ggagggcaggaggtctctgacaatgaactccaagaactgtccactcaagggagtaggtat
attaataaggagattcagaatgccgtccagggagtgaagcacataaaatccctcatagaa
aaaaccaacgcggagcgcaagtccctgctcaacagtttagaggaagccaagaagaggaaa
gaggatgctctggaggacaccagggattctgaaatgaagctgaaggcattcccggaagtg
tgtaacgagaccatgatggccctctgggaggagtgcaagccctgcctgaagcacacttgc
atgaagttctatgcacgcgtctgcaggagcggctcggggctggtcggccagcagctagag
gagtttctgaaccagagctcacccttctacttctggatgaacggcgaccgcatcgactcc
ctgctggagagtgaccggcagcagagccaagtcctggatgccatgcaagacagctttgca
cgggcatctggcatcatagacacgctcttccaggaccggttcttcacccatgagccccgg
gacccccactacttctcccccatcggcttcccacataagaggcctcatttcttatatccc
aagtcccgcttggtccgcagcctcatgcctccctcctactatgggcctccgagcttccac
accatgttccagcctttctttgacatgatccaccaggctcaacaggccatggatgtccag
ctccacagcccagccttccagttcccggacgtggatttcttaagagaaggtgaagatgac
cgaacagtgtgtaaggagatccgccgcaactccacaggatgcctgaagatgaagggccag
tgtgagaagtgccaggagatcttgtctgtagactgttcaaccaacaatcccgcccaggct
aacctgcgccaggagctgaacgactcgctccaggtggctgagaggctgaccgagcagtac
aaggagctgctgcattccttccagtctaagatgctcaacacctcatccctgctggagcag
ctgaacgaccagttcaactgggtgtcccagctggctaacctcacacagggcgaggacaag
tactaccttcgggtctccaccgtgaccacccattcttctgactctgaggtcccctcccgt
gtcactgaggtggtggtgaagctgtttgactctgaccccatcacggtggtgttaccagaa
gaagtctctaaggataaccctaagtttatggacacagtggcggagaaggcgctacaggaa
taccgcaggaaaagccgcgcggaatga

DBGET integrated database retrieval system