KEGG   Mus pahari (shrew mouse): 110326390
Entry
110326390         CDS       T05929                                 

Gene name
Gli1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110326390 (Gli1)
   04024 cAMP signaling pathway
    110326390 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326390 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110326390 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110326390 (Gli1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110326390 (Gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8 IL17
Other DBs
NCBI-GeneID: 110326390
NCBI-ProteinID: XP_021060449
Ensembl: MGP_PahariEiJ_G0031192
LinkDB
Position
9
AA seq 1110 aa
MFNPMTPPQVNSYGEPCCLRPLHSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGAARETS
SCTEGSLFPPPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPG
GSYGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTRGSMMLHPQSRGPRATCQ
LKSELDMMVGKCPEDPLEGDMSSPNSTGTQDHLLGMLDGREDLEREEKPEPESVYETDCR
WDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGE
KPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHSN
EKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKRER
EGGSGREESRLTVPEGAMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTEDLS
SLDEGPCVAATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVSL
DRRSSSSSSMSSAYTVSRRSSLASPFPPGTPPENGASSLPGLTPAQHYMLRARYASVRGT
GTPPTAAHSLDRMGGLPVPPWRSRTEYPGYNPNAGVTRRASDPARAADHPAPARVQRFKS
LGCVHTPPSVATGQNFDPHLPTSVYSPQPPSITENVAMDTRGLQEEPEVGTSVMGNGLNP
YMDFSSADTLGYGGPEGTAAEPYEARGPGSLPLGPGPPTNYGPGHCAQQVSYPDPTPETW
GEFPSHAGVYPGNKAPGAPYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
SPGPQPMFSHHPQLPQPQYPQSGPYPQPPHGYLSSEPRPGLNFNPSSSHSTGQLKAQLVC
NYVQSQQGLWEGRSRGGLPNQELPYQSPKFLGGSQVSQSPAKTPAVAAAAAAYGSGFAPA
SANHKSGSYPAPSQCHETFTVGVNRPSHRPAPPRLLPPLSPCYGPLKVGDTNPSCGHPEV
GRLGAGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDETQGLSPPLSHEQGDSSKNTPP
PSGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgttcaatccaatgactccgccacaagtcaatagctatggtgaaccatgttgtctccga
cccctccacagtcaaggagtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaactttatgtcagggtcccagggttatggagcagccagagagaccagc
agctgcactgaaggatctctctttcctcctcctcctcctcggagttcagtcaaattaaca
aagaagcgggctctctccatttcgcccctctcggatgccagcctcgacctacaaaccgta
atccggacctcacccagctccctcgtggctttcatcaactctcgctgtacatctccgggc
ggttcctacggccatctctccattggcaccatgagcccttctttaggattcccacctcag
atgagtcatcaaaaaggaacttcacctccctatggagtccagccctgtgttccacatgac
tctactcggggttcaatgatgcttcacccccagtcccggggaccacgtgcaacctgccag
ctgaagtcagagctggacatgatggttggcaagtgcccggaggaccctttggaaggggac
atgtctagccccaactccacaggcacacaggatcacctgctggggatgctggatgggcgg
gaggacctggagagagaggagaaacctgagcctgagtctgtgtatgagacagactgccgc
tgggatggttgcagccaggagttcgattcccaggagcagctggtgcaccacatcaacagt
gagcatatccacggggagcggaaggaatttgtgtgccactggggaggttgctccagagag
ctgagacccttcaaggcccaatacatgctggtggtgcacatgcgcagacacacgggcgag
aagccgcacaagtgcacgtttgaaggctgtcggaagtcctattcacgcctcgaaaacctc
aagacgcacctgcggtcgcacacgggcgagaagccttacatgtgtgagcaagaaggttgc
agcaaggcctttagcaatgccagtgaccgcgccaagcaccagaatcggacccactccaat
gagaagccatacgtgtgcaagctccccggctgcaccaagcgctacacagatcccagctcg
ctccgcaaacacgtcaagacagtgcacggtccggatgcccacgtgaccaagcggcatcga
ggggatggccccttgccacgggcgcagcccctctctacagtggagcccaagcgggaaagg
gaaggaggatcaggcagggaagagagcagactgactgtgcccgagggtgccatgccacag
cagagccccggagcacaatcctcctgcagcagcgaccactccccagcaggcagtgcggcc
aacacggacagcggcgtggagatggccggcaacgccgggggcagcactgaggacttgtcc
agcttggatgaaggaccttgtgttgcggccaccggactttccacgcttcgccgcctggag
aacctcaggctggatcagctgcatcagctccgaccaatagggtctcggggtctcaaactg
cccagcttaacccacgcaggcgcacctgtgtctcgccgtctgggccccccagtctccctt
gaccgccgcagcagcagctccagcagcatgagctctgcttacacagtcagccgcaggtcc
tccctagcatcccctttcccgccgggaaccccaccagagaatggggcatcgtcactacct
ggcctcacacctgctcagcactacatgctccgtgccagatatgcttcagtcagggggact
ggcaccccgcccactgcagcgcacagcctggaccggatgggaggtcttcctgttcctcct
tggagaagccggaccgaatacccgggatacaacccaaatgcaggggtcactcggagggcc
agtgacccagcgcgggctgcagaccacccagctccagccagagtccaacggttcaagagc
ctgggatgtgtccacacgccccctagtgtggcaacgggacagaacttcgatccccacctc
cctacctccgtctattcgccacagccccccagcatcaccgaaaatgttgccatggatact
agggggctacaggaggagccagaagttggaacttctgtgatgggcaatggtctgaaccca
tacatggatttttcctccgctgataccctgggatatggggggcctgaggggacggcagct
gagccttatgaagctaggggtccaggttccctgcctcttgggcctggtccaccaaccaac
tatggccctggccactgtgctcagcaggtctcctatcctgatcccaccccagaaacatgg
ggtgagtttccttctcatgctggggtgtaccctggcaataaggctcctggtgctccctat
agccagtgtcctcgacttgagcattatggacaagtgcaggtaaaaccagaacaagggtgc
cccgtggggtctgactccaccggattggcaccctgcctcaatgcccaccccagtgaaggg
tccccaggcccgcagcctatgttttcacatcacccccagctccctcagccccagtatccc
caatcgggtccctatcctcagcctccccatggttatctctcatcagaacccaggcctggc
ctcaattttaacccctcctcctctcattccacaggacagctcaaagctcagctcgtgtgt
aattacgttcagtcgcagcagggactgtgggagggaagaagccggggagggctccccaac
caggaactcccataccagagccccaagtttctggggggttcccaagttagtcagagccct
gccaagaccccagcagtagcagcagcagcagcagcatatggatctggctttgcacctgct
tcggccaatcacaaatcaggctcctatcctgccccttcgcagtgccatgaaactttcacc
gtgggagtaaacaggccttcccacaggccagcaccaccccgacttctgcccccactgtcc
ccttgctatgggcccctcaaggtgggggataccaaccccagttgtggccatcctgaggtg
ggcaggttaggagcaggccctgccttgtaccctccccctgaagggcaggtgtgtaacccg
ctggactctcttgacctggacaacactcagctggactttgtggcaatcctagatgagacc
cagggcctgagccctcctctttcccatgagcaaggggacagctctaaaaacaccccaccc
ccctctgggccccccaacatggcagtgggtaacatgagtgtcttgctggggtctctgcct
ggagagactcaattcctcaactctagtgcctaa

DBGET integrated database retrieval system