KEGG   Mus pahari (shrew mouse): 110326585
Entry
110326585         CDS       T05929                                 
Symbol
Vsir
Name
(RefSeq) V-type immunoglobulin domain-containing suppressor of T-cell activation
  KO
K23268  V-type immunoglobulin domain-containing suppressor of T-cell activation
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110326585 (Vsir)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 110326585
NCBI-ProteinID: XP_021060789
Ensembl: MGP_PahariEiJ_G0030772
LinkDB
Position
9:25734756..25757367
AA seq 311 aa
MGVPTVPEASSRPRWRTLLLAIFLAASRGLVAAFRVATPYSLYVCPEGQNATLTCRILGP
VSKGHDVTVYKTWYLSSRGEVQMCKEHRPIRNLTSQHLHQHHGGHLEANASHDQPQKHGL
ELASDHHGNFSITLHNVTLRDSGLYCCLVIEFKHHHPEQRFYGSMELQVQAGKGSGSTCT
ASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVVSHRRAQELVRMDSGNTQGI
ENPGYETTPPYQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLD
PVPDSPNSEAI
NT seq 936 nt   +upstreamnt  +downstreamnt
atgggtgtccccacggtcccagaggccagcagccgcccgcgctggagaaccctgctcctc
gctattttcctggctgcatccagaggtctggtagccgccttcagggtcgccactccatat
tctctctatgtgtgtcccgagggtcagaacgccaccctcacctgcaggattctgggcccc
gtgtccaaagggcacgatgtgaccgtctacaagacatggtacctcagctcacgaggcgag
gtccagatgtgcaaagaacaccggcccatacgcaacttgacatcacagcaccttcatcag
caccacggaggccacctggaagccaacgccagccatgaccaaccccagaagcatgggctg
gagttagcttctgaccaccatggtaacttctctatcaccctgcacaacgtgaccctgagg
gacagtggcctctactgctgcctggtgatagaattcaagcaccaccacccagaacaacgg
ttctacgggtccatggagctacaggtacaggcaggcaaaggctcggggtccacatgcacg
gcgtctaatgagcaggacagcgacagcatcacggctgcggccctggccaccggcgcctgc
atcgtgggaatcctctgcctcccccttatcctgctgctggtctataagcagaggcaggtg
gtctctcaccgccgtgcccaggagctggtgaggatggacagcggcaacacccaagggatc
gaaaacccaggctacgagaccactccaccctaccaggggatgccggaggccaagaccagg
cctccactgtcctatgtggcccagcggcaaccttccgagtcagggcggtacctactctct
gaccccagcacacctctgtcgcctccaggccctggggatgtctttttcccatccctagat
ccggtccctgactcccctaactctgaagccatctaa

DBGET integrated database retrieval system