Mus pahari (shrew mouse): 110326917 Help Entry 110326917         CDS       T05929                                  Symbol Cd24 Name (RefSeq) signal transducer CD24   KO K06469   CD24 antigen Organism mpah  Mus pahari (shrew mouse) Pathway mpah04148   Efferocytosis mpah04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:mpah00001]  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     110326917 (Cd24)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110326917 (Cd24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:mpah04090]     110326917 (Cd24)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]     110326917 (Cd24) CD molecules [BR:mpah04090]  Proteins   110326917 (Cd24) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]  Antigens   110326917 (Cd24) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD24 Motif Other DBs NCBI-GeneID:  110326917 NCBI-ProteinID:  XP_021061230 LinkDB All DBs Position 9:9806482..9810864 Genome browser AA seq 76 aa AA seqDB search MGRAMVARLGLGLLLLALLLPSQIYCNQTSVAPFSGNQNISASPNPSNATTRAGGSSLQS TAGLLALSLSLLHLYC NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggcagagcgatggtggccaggctagggctggggttgctgcttctggcactactccta ccctcgcagatttactgcaaccaaacatctgttgctccgttttccggtaaccagaatatt tctgcttccccaaatccaagtaacgctaccaccagagcgggtggcagctccctgcagtcc acagctggcctcctggccctctctctctctcttctacatctctactgttag

DBGET integrated database retrieval system