Mus pahari (shrew mouse): 110327006 Help Entry 110327006         CDS       T05929                                  Symbol Cstb Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism mpah  Mus pahari (shrew mouse) Brite KEGG Orthology (KO) [BR:mpah00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mpah01002]     110327006 (Cstb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110327006 (Cstb) Peptidases and inhibitors [BR:mpah01002]  Peptidase inhibitors   Family I25: cystatin family    110327006 (Cstb) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110327006 (Cstb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  110327006 NCBI-ProteinID:  XP_021061352 Ensembl:  MGP_PahariEiJ_G0030922 LinkDB All DBs Position 9:43100602..43102555 Genome browser AA seq 98 aa AA seqDB search MMCGGPSATMPATAETQEIADKVKSQLEEKENQKFDAFKAVSFKRQVVAGTNFFIKVDVG DDKYVHLRVFQPLPHENKPLTLSSYQTNKEKHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgtggcggcccatctgccacaatgccagccacggccgagacgcaggagatcgcc gacaaggtgaagtcccagcttgaagagaaagaaaatcagaagtttgatgcctttaaagcc gtatccttcaagagacaggtcgtggctggcaccaacttcttcatcaaggttgatgttggt gacgataaatatgtgcacttgagggtgttccaacccctccctcatgaaaacaagcctttg accctgtcttcttaccagaccaacaaagaaaagcacgatgagctctcctacttctga

DBGET integrated database retrieval system