KEGG   Mus pahari (shrew mouse): 110327633
Entry
110327633         CDS       T05929                                 
Symbol
Nectin1
Name
(RefSeq) nectin-1
  KO
K06081  poliovirus receptor-related protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04520  Adherens junction
mpah05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327633 (Nectin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110327633 (Nectin1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110327633 (Nectin1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110327633 (Nectin1)
   04090 CD molecules [BR:mpah04090]
    110327633 (Nectin1)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  Nectin family
   110327633 (Nectin1)
CD molecules [BR:mpah04090]
 Proteins
  110327633 (Nectin1)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 Ig_2 ig I-set
Other DBs
NCBI-GeneID: 110327633
NCBI-ProteinID: XP_021062377
Ensembl: MGP_PahariEiJ_G0014962
LinkDB
Position
10:38848948..38911866
AA seq 515 aa
MARMGLAGAAGRWWGLALGLTAFFLPGIHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSV
KITQVTWQKASNGSKQNMAIYNPTMGVSVLPPYEKRVEFLRPSFIDGTIRLSSLELEDEG
MYICEFATFPTGNRESQLNLTVMAKPTNWIEGTRAVLRARKGQDDKVLVATCTSANGKPP
SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHRQSLACIVNYHLDRFRESLT
LNVQYEPEVTIEGFDGNWYLQRTDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFRGPITYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPTPEHGRRAGQMPTAIIGGVA
GSVLLVLIVVGGIIVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPDD
SDDEKKAGPLGGSSYEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYG
DRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctcggatggggcttgcgggcgccgctggacgctggtggggactcgctctgggcttg
accgccttcttcctcccaggcattcacacgcaggtggtgcaggtgaacgactccatgtat
ggcttcatcggcacagatgtggtactgcactgtagctttgccaacccgctgcccagtgtg
aaaatcacccaggtcacatggcagaaggcctccaatggctccaagcagaacatggccatc
tacaacccgacaatgggtgtgtccgtgctgcctccctacgagaaacgagtggagttcctg
cgaccctccttcatcgatggcaccatccgcctctccagtctggagctggaggacgagggc
atgtacatctgtgaatttgccaccttccctacaggcaaccgtgagagccagctcaatctc
actgtgatggccaaacccaccaactggatcgagggcacccgggcggtgcttcgagccagg
aagggacaggatgacaaggtcctggtggccacctgcacctcagccaatgggaagcccccc
agtgtggtgtcctgggaaacacggctaaagggcgaggcagagtaccaggaaattcggaac
cccaacggcactgtgacagtcatcagccgttaccgcttggtgcccagcagggaggcccac
cggcagtccttggcctgcatcgtcaactatcacctggatcgcttcagggagagcctgacg
ctcaatgtgcagtatgaacctgaggtgaccatcgagggctttgatggcaactggtatctg
cagcggacagatgtgaagctcacgtgcaaagcagacgctaacccgccagccactgagtac
cactggaccacgttgaatggctctctccccaagggtgtagaggcccagaacaggaccctc
ttcttccggggacctatcacctacagcctggcaggaacctacatctgtgaggccaccaac
cctattggcacccgatcgggccaggtggaggtcaatatcacagaattcccctacaccccg
actcctgaacacgggcggcgcgcggggcagatgcccacagccatcattgggggcgtggca
ggaagtgtcctgctggtgctgattgtggttggagggatcatagtggccctgcgcaggcgc
cggcacaccttcaagggtgactacagcaccaagaagcacgtgtacggcaacggctacagc
aaggcaggcatcccgcagcatcacccgcccatggcacagaacctgcagtacccggatgac
tcggatgatgaaaagaaggccggcccgttgggcgggagcagctatgaggaggaagaggag
gaggagggcggtggaggaggcgaacgcaaggtgggcggcccccaccccaaatatgacgag
gacgccaaacggccctactttactgtggatgaggctgaagcccgtcaggacggctatggg
gaccggactctgggctaccagtacgaccctgaacagctggacttggctgagaacatggtt
tctcagaacgacgggtctttcatttccaagaaagagtggtatgtgtag

DBGET integrated database retrieval system