KEGG   Mus pahari (shrew mouse): 110327722
Entry
110327722         CDS       T05929                                 
Symbol
Jam3
Name
(RefSeq) junctional adhesion molecule C
  KO
K06785  junctional adhesion molecule 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327722 (Jam3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110327722 (Jam3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110327722 (Jam3)
SSDB
Motif
Pfam: Ig_3 I-set ig V-set Ig_2 C2-set_2 Ig_6 Izumo-Ig Protocadherin
Other DBs
NCBI-GeneID: 110327722
NCBI-ProteinID: XP_021062558
Ensembl: MGP_PahariEiJ_G0014792
LinkDB
Position
10:complement(22129400..22189548)
AA seq 311 aa
MALSRRWLRLRLCARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQ
TSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVA
LSDRKEVDEITIELIVQVKPVTPVCRVPAAVPVGKKATLQCQESEGYPRPHYSWYRNDVP
LPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYD
LNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFLSSKQDGESYKSPGKHDSVNYIRTSEE
GDFRHKSSFVI
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcgctgagccggcggtggctgcgacttcggctgtgcgcgcgactgcctgacttcttc
ctgctgctgctcttcaggggctgcatgatagaggcagtgaatctcaaatccagcaaccga
aacccagtggtacatgaatttgaaagtgtggaattgtcttgcatcattacggactcacag
acaagtgaccctaggattgaatggaagaaaatccaagatggccaaaccacatatgtgtat
tttgacaacaagattcaaggagacctggcaggtcgcacagatgtgtttggaaaaacttcc
ctgaggatctggaatgtgacacggtcagattcagccatctatcgctgtgaggtcgttgct
ctaagtgaccgaaaagaagttgatgagattaccattgagctaattgtgcaagtgaagcca
gtgacccctgtctgcagagttccagccgctgtgcctgtaggcaagaaggcaacactgcag
tgccaagagagcgagggctatcctcggcctcactacagctggtaccgcaatgatgtgcca
ctgcctacagattccagagccaatcccaggttccagaattcctctttccacgtgaactcg
gagacaggcactctggttttcaatgctgtccacaaggatgactctgggcagtactactgc
attgcttccaatgacgcaggtgcagccaggtgtgaggggcaggacatggaagtctatgat
ttgaacattgctgggattattgggggagtccttgttgtccttattgttcttgctgtgatt
acgatgggcatctgctgtgcgtacagacgaggctgcttcctcagcagtaaacaagatgga
gaaagttataagagcccagggaagcatgacagtgtcaactacatcaggacgagtgaggag
ggtgacttcagacacaaatcgtcctttgttatctga

DBGET integrated database retrieval system