KEGG   Mus pahari (shrew mouse): 110327862
Entry
110327862         CDS       T05929                                 
Symbol
Myd88
Name
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04936  Alcoholic liver disease
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05164  Influenza A
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110327862 (Myd88)
   04064 NF-kappa B signaling pathway
    110327862 (Myd88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110327862 (Myd88)
   04621 NOD-like receptor signaling pathway
    110327862 (Myd88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110327862 (Myd88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110327862 (Myd88)
   05161 Hepatitis B
    110327862 (Myd88)
   05171 Coronavirus disease - COVID-19
    110327862 (Myd88)
   05164 Influenza A
    110327862 (Myd88)
   05162 Measles
    110327862 (Myd88)
   05168 Herpes simplex virus 1 infection
    110327862 (Myd88)
   05169 Epstein-Barr virus infection
    110327862 (Myd88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110327862 (Myd88)
   05135 Yersinia infection
    110327862 (Myd88)
   05133 Pertussis
    110327862 (Myd88)
   05134 Legionellosis
    110327862 (Myd88)
   05152 Tuberculosis
    110327862 (Myd88)
  09174 Infectious disease: parasitic
   05144 Malaria
    110327862 (Myd88)
   05145 Toxoplasmosis
    110327862 (Myd88)
   05140 Leishmaniasis
    110327862 (Myd88)
   05142 Chagas disease
    110327862 (Myd88)
   05143 African trypanosomiasis
    110327862 (Myd88)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110327862 (Myd88)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110327862 (Myd88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 110327862
NCBI-ProteinID: XP_021062770
Ensembl: MGP_PahariEiJ_G0015665
LinkDB
Position
10:complement(112230977..112234969)
AA seq 296 aa
MSAGGPRVGSVSLDSLMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLE
IRELETHPDPTRSLLDAWQGRSSASVGRLLELLALLDREDILKELKSRIEEDCQKYLEKQ
QSQESEKPLQVARVESSIPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtctgcgggaggcccccgcgtgggatccgtgtccctggactccctcatgttctccata
cccttggtcgcgcttaacgtgggagtgaggcgccgcctatcgctgttcttgaaccctcgg
actcccgtggcggccgactggaccttgctggcggaggagatgggcttcgagtacttggag
atccgagagctggagacgcaccccgaccccactcgcagtttgttggatgcctggcagggg
cgctctagcgcgtcggtcggcaggctgctagagttgctggccttgttagaccgtgaggat
atactgaaggagctgaagtcccgcatcgaggaggactgccagaaatacttagagaagcag
cagagccaggagtccgagaagcccttacaggtggccagagtggaaagcagtatcccacaa
acaaaggaactgggaggcatcaccacccttgatgaccccctgggacaaacaccagagctt
ttcgatgcctttatctgctactgccccaatgatatcgagtttgtgcaggagatgatccgg
caactagaacagacagactatcggcttaagttgtgcgtgtccgatcgtgacgtcctgccg
ggcacctgtgtctggtccattgccagtgagctaattgagaaaaggtgtcgccgcatggta
gtggttgtttctgatgattatctacaaagcaaggaatgtgacttccagaccaagtttgca
ctcagcctgtctccaggcgtccaacagaagcgactgattcctattaaatacaaggcgatg
aagaaggactttcccagtatcctgcggttcatcactatatgtgactataccaacccttgc
accaagtcctggttctggacccgccttgccaaggctttgtccctgccctga

DBGET integrated database retrieval system