KEGG   Mus pahari (shrew mouse): 110327915
Entry
110327915         CDS       T05929                                 
Symbol
Cd276
Name
(RefSeq) CD276 antigen
  KO
K06746  immune costimulatory protein B7-H3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327915 (Cd276)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110327915 (Cd276)
CD molecules [BR:mpah04090]
 Proteins
  110327915 (Cd276)
SSDB
Motif
Pfam: Ig_3 ig Ig_2 V-set I-set C2-set_2 C1-set DUF4381
Other DBs
NCBI-GeneID: 110327915
NCBI-ProteinID: XP_021062855
Ensembl: MGP_PahariEiJ_G0015161
LinkDB
Position
10:complement(53421961..53439258)
AA seq 316 aa
MLRGWGGPSVGVCMRAALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSY
TCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKD
GQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQ
PLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALR
PLKHSENKEDDGQEIA
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcttcgaggatggggtggccccagtgtgggtgtgtgtatgcgcgcagcgctgggggtg
ctgtgcctctgcctcacaggagctgtggaggtccaggtctctgaagaccccgtggtggcc
ctggtagacacagatgccaccctacgctgctccttttccccagagcctggcttcagtctg
gcacaactcaacctcatctggcagctgacagacaccaaacagctggtgcacagcttcacg
gagggccgggaccaaggcagtgcctacgccaaccgcactgcgctcttccctgacctgttg
gtgcagggcaatgcgtccttgaggctgcagcgtgtccgagtaactgatgagggcagctac
acctgctttgtgagcatccaggactttgacagcgctgctgttagcctgcaggtggccgcc
ccctactcgaagcccagcatgaccctggagcccaacaaggacctgcgtccaggggacatg
gtgaccatcacgtgctccagctaccagggctatccggaggccgaggtgttctggaaggac
ggacagggagtgcccttgactggcaatgtgaccacatcccagatggctaacgagcggggc
ttgttcgatgttcacagcgtgctgagggtggtgctgggtgctaacggcacctacagctgc
ctggtacgcaacccggtgttgcagcaagatgctcacggctcagtcaccatcacagggcag
cccctgacattcccccctgaggctctgtgggtgaccgtggggctctctgtctgtcttgtg
gtactgctggtggccctggccttcgtgtgctggagaaagatcaagcagagctgtgaggag
gagaatgcaggtgctgaggaccaggatggagatggagaaggatccaagacagctctacgg
cctctgaaacactctgaaaacaaagaagatgatggacaagaaattgcttga

DBGET integrated database retrieval system