KEGG   Mus pahari (shrew mouse): 110327920
Entry
110327920         CDS       T05929                                 
Symbol
Esam
Name
(RefSeq) endothelial cell-selective adhesion molecule
  KO
K06787  endothelial cell adhesion molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110327920 (Esam)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110327920 (Esam)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set Ig_6 Sema4F_C RTX Izumo-Ig Nitrate_red_gam
Other DBs
NCBI-GeneID: 110327920
NCBI-ProteinID: XP_021062863
Ensembl: MGP_PahariEiJ_G0014848
LinkDB
Position
10:32075866..32086353
AA seq 394 aa
MILPAGTPETRLLRVLFVGLSTLAAFSRAQMELHVPPGLNKLEAVEGEEVVLPAWYTMAR
EESSSHPWEVPVLIWFLEQEGKEPNQVLSYINGALTNKPGVALVHSISSRNVSLHLEALQ
EGDSGTYRCSVNVLNDEGKSMGHSIKSIELKVLVPPAPPSCSLQGVPYVGTNVTLNCKSP
RSKPTAQYQWERLAPSSQVFFGPALDAVRGSLKLTNLSTAMSGVYVCKAQNRVGIARCNV
TLDVMTGSKAAVVAGAVVGTFVGLVLIAGLVLLYQRRSKTLEELANDIKEDAIAPRTLPW
TKGSDTISKNGTLSSVTSARALRPPKAAPPRPGAFTPTPSVSSQALSSPRLPRTDEPPPQ
AVSLTPGGVSSSALSRMGAVPVMVPAQSQAGSLV
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgattcttccggctggaacccccgagaccagattgctgcgggttttgttcgtgggactg
agtactcttgctgccttctcccgggctcagatggagttgcacgtgcccccgggcctcaac
aaattggaggcggtagagggagaagaagtggtgctccccgcttggtacacgatggcacgg
gaggagtcgtcgtcccacccctgggaggtgcccgtcctgatttggttcttggaacaagaa
gggaaggaaccaaaccaggtgttgtcttacattaatggggccttgacaaataaacctgga
gtagccctggtccactctatctcttcacggaatgtgtccctgcacctggaggcgctccag
gagggagactctgggacctaccgatgttctgtcaatgtgctaaatgatgaaggcaaaagt
atgggccacagcatcaaaagcatagagctcaaagtgctggttcctccagctcctccatcc
tgtagtttacagggtgtaccctatgtcgggaccaatgtgaccctgaactgcaagtcccca
aggagtaaacctactgctcagtaccagtgggagaggctggccccatcttcccaggtcttc
tttggaccagccttagatgcagtccgtggatctttaaagctcaccaacctttccactgcc
atgtctggagtctatgtctgcaaggcccaaaacagagtgggcattgcccggtgcaatgtg
accttggacgtgatgacagggtccaaggctgcagtggttgctggagcagttgtgggcact
tttgttgggttggtgctgatagctgggctggtcctgttgtaccaacgccggagcaagacc
ctggaagagctggccaatgatatcaaggaagatgccattgctccccggaccttgccttgg
accaaaggctcagacacaatctccaagaatgggaccctttcttcggtcacctcagcgcga
gctctgcggccacccaaggctgctcctccaagacccggcgcatttactcccacacccagt
gtctctagccaggccctgtcctcaccaagactgcccaggacagatgaacccccacctcag
gcagtgtccctgaccccaggtggggtttcttcttctgctctgagccgcatgggtgctgtg
cctgtgatggtgcctgcacagagtcaggctgggtctcttgtgtga

DBGET integrated database retrieval system