KEGG   Mus pahari (shrew mouse): 110328212
Entry
110328212         CDS       T05929                                 
Symbol
Neo1
Name
(RefSeq) neogenin isoform X1
  KO
K06766  neogenin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110328212 (Neo1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110328212 (Neo1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110328212 (Neo1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 fn3_2 Tissue_fac Izumo-Ig SusE TMEM154 EphA2_TM Herpes_UL74 FAM176
Other DBs
NCBI-GeneID: 110328212
NCBI-ProteinID: XP_021063269
Ensembl: MGP_PahariEiJ_G0015165
LinkDB
Position
10:complement(53786773..53946207)
AA seq 1494 aa
MAAEREAGRLLCTSSSRRCCPPPPPPPLLLLLLLLLLGHPASGAAAAKSSSPSQSAGASV
RTFTPFYFLVEPVDTLSVRGASVILNCSAYSEPSPNIEWKKDGTFLNLVSDDRRQLLPDG
SLFISNVVHSKHNKPDEGFYQCVATVDNLGTIVSRTAKLTVAGLPRFTSQPEPSSVYVGN
SASLNCEVNADLVPFVRWEQNRQPLLLDDRIVKLPSGTLVISNATEGDGGLYRCIVESGG
PPKFSDEAELKVLQGPEETVDLVFLMRPSSMMRVTGQSAVFPCVVSGLPAPVIRWMKNDD
VLDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNKTVEAQAELTVQVPPGFLKQP
ANIYAHESMDIVFECEVTGKPTPTVKWVKNGDVVIPSDYFKIVKEHNLQVLGLVKSDEGF
YQCIAENDVGNAQAGAQLIILEHDVAIPTLPPTSLTSATTDHLAPATTGPLPSAPRDVVA
SLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGVARERVENTSQPGEMQVTIQNLMPAT
VYIFKVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTWETPLSGNG
EIQNYKLYYMEKGTDKEQDIDVSSLSYTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVR
TLSDVPSAAPQNLSLEVRNSKSIVIHWQPPSSTTQNGQITGYKIRYRKASRKSDVTETLV
TGTQLSQLIEGLDRGTEYNFRVAALTVNGTGPATDWLSAETFESDLDETRVPEVPSSLHV
RPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVI
TLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSH
DTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYE
FSVMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKI
TGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAV
QFRTPKADSSDKMPNDQALGSAGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLV
IIVSVGVITIVVVVVIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNCKDVKPPDLWIHH
ERLELKPIDKSPDPNPVMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTL
AGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPSSPWPI
GTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQS
LPTAHVRPSHPLKSFAVPAIPPPGPPIYDPALPSTPLLSQQALNHHIHSVKTASIGTLGR
SRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA
NT seq 4485 nt   +upstreamnt  +downstreamnt
atggcggcggagcgcgaagccgggcgactcctctgcacctcctcctcccggcgctgctgc
ccgccaccgccgccgccgccgctgctgctgctgctgctgctgctgctgctcgggcacccg
gcgtccggcgccgcggccgcgaagagcagctccccgtcgcagtccgcaggagccagtgtt
cgaacattcactccgttttattttctggtggagccagtagacaccctctcagttagaggt
gcttctgttatactaaattgctcggcgtattctgagccttctccaaacattgaatggaag
aaagatggaacttttttaaacttagtatcagatgaccgccgacagcttctcccagatgga
tctttattcatcagcaacgtggtgcattccaaacacaataagcccgatgaaggtttctat
cagtgtgtagccactgttgataatcttggaactattgtcagcagaacagccaagctcaca
gtagcaggtcttccaagatttaccagccaaccagaaccttcttcagtctatgttggaaac
agtgcaagtctgaattgtgaagttaatgcagatttggtcccatttgttaggtgggaacag
aatcgacagccccttcttctagatgacaggattgtcaaacttccaagtggaacactggtt
atcagcaatgctactgaaggagatgggggactctaccgctgcattgttgaaagtggtggg
ccaccaaagtttagtgatgaagctgaattgaaagttcttcaaggtcctgaggaaactgta
gacttggtatttttgatgcgaccatcttctatgatgagagtcactggtcagagtgcagtg
tttccatgtgttgtctcagggcttcctgctccagtcattagatggatgaaaaatgatgac
gtgcttgacacagaaagctctgaaaggttggtcttgctagcaggaggtagtttggagatc
agtgatgtcactgaggatgatgctggcacttatttttgtatagctgataatggaaataag
acagttgaagctcaggcggagcttactgtgcaagtgccacctggattcttgaaacaacct
gctaacatatatgctcatgaatccatggatattgtatttgaatgtgaagtcactgggaag
ccaactccaactgtgaagtgggtcaagaatggggatgtggttatccccagtgattacttt
aaaattgtaaaggaacataatcttcaagttttgggtctggtgaagtcagatgaagggttc
tatcaatgcattgcagagaatgatgttggaaatgcacaagctggagcccagctgataatc
cttgagcatgatgttgccatcccaacattacctcccacttcactgaccagtgccactact
gaccatctagcaccagccacaacgggaccactaccttcagctcctcgagacgtcgtggcc
tccctggtctctactcgcttcattaaattgacatggcgtacacctgcatcagaccctcat
ggagacaatctcacctattctgtgttctacacgaaggaaggggttgctagggagcgtgtt
gagaataccagtcagccaggagagatgcaggtgactattcaaaacttgatgccagcaact
gtgtacatcttcaaagtcatggctcaaaataagcatggctctggagaaagttcagctcct
ctacgagtagagacgcagcctgaggttcagctccctggcccagcacctaatatccgcgct
tatgcaacgtcacctacttctatcactgtcacatgggaaacaccgttatctggcaatggg
gaaattcagaattacaaattgtactacatggaaaaaggaactgataaagaacaggatatt
gatgtttcaagtctctcctacaccattaatggactgaagaaatatacagaatatagtttc
cgagttgtggcctacaataaacatggtcctggagtttctacacaagatgttgctgtccga
acattatcagatgttcccagtgctgctcctcagaatctgtccttagaagtgagaaattca
aagagtatagtgatccactggcagcccccttcctcaaccacacaaaatgggcagataact
ggctacaagattcgatatcgaaaggcctcccgaaaaagtgatgtcactgagaccttggta
actgggacacagctgtctcagctgattgaaggtcttgatcgggggaccgaatataacttc
cgagtcgctgctctcacagtcaatggtacaggtccagcaactgattggctgtctgctgaa
acttttgaaagcgacctagatgaaactcgtgttcctgaagtgcccagctctcttcatgtc
cgtccgctcgtcactagcattgtagtgagctggactcctccagagaaccagaacattgtg
gtccgaggttatgccatcggttatggcattggcagccctcatgcccagaccatcaaagtg
gactataaacaacgttattacaccatcgaaaacttggatccaagctctcattacgtgatt
accttgaaagcatttaacaatgttggcgaaggcatccccctttatgagagtgctgtgacc
agacctcacacagacacttctgaagttgatttatttgttattaatgctccatacactcca
gtgccagatcccactcccatgatgccaccagtgggagttcaggcttccatcctgagtcat
gacaccataaggattacctgggcagacaactccctgcccaaacaccagaagattacagac
tcccgctactacacagtccggtggaagaccaacattccagcaaacaccaagtacaagaat
gcaaatgcaacaacgttaagctatttggttactggtttaaagccaaatacactctatgag
ttctctgtgatggtgaccaaaggtagaaggtcaagcacgtggagtatgacagctcatggc
gctacctttgaattagttcctacttctccacctaaggatgtgacggttgtgagtaaggaa
ggaaaacctagaaccatcatagtgaactggcagcctccctctgaagccaatggcaagatt
acaggttacatcatctattacagcacagatgtgaatgcagagattcacgactgggttatt
gaaccagttgtgggaaacagactaactcaccagattcaagagttaacacttgatacacca
tactacttcaaaatccaggcccggaactccaagggcatgggacccatgtctgaagctgta
cagttcagaacacctaaagcggactcctctgataaaatgcctaatgaccaagccttaggg
tcagcaggaaaaggaagccgactaccagacctgggatccgactacaaacctccaatgagt
ggaagcaacagccctcatgggagccccacctcccctctggacagcaacatgctgctggtc
atcattgtctctgttggcgtcatcaccattgtggtggttgtggtcattgctgtcttttgt
acccggcgcaccacctctcaccagaagaagaaacgagctgcatgcaaatcagtgaatggc
tcccataagtacaagggcaattgcaaggatgtgaagcctccagacctatggatccatcac
gagagactagagttgaagcctattgacaaatctccagatcctaaccctgtcatgactgat
actccaatccctcgaaactctcaagatatcacaccagtggacaattccatggatagcaat
atccatcaaaggcggaattcatacagagggcatgagtcagaggacagcatgtctacactg
gctggaaggaggggaatgagaccaaaaatgatgatgccctttgactctcagccacctcag
cctgtgattagtgcccatcccatccattccctcgataaccctcaccatcatttccactcc
agcagcctcgcttctccagcccgcagtcatctctaccacccaagcagcccatggcccatt
ggcacatccatgtccctttcagacagggccaattccacagaatctgttcgaaataccccc
agcacggacaccatgccagcatcttcgtctcagacatgctgcactgaccatcaggatcct
gaaggtgctactagctcctcttacttggccagctcccaagaggaagattcaggccagagt
ctccccacagcccatgtccgcccttcccacccactgaagagcttcgctgtgccagcaatc
ccacccccaggacctcctatctatgatcctgcactgccaagcacaccattactgtcccag
caagctctgaaccatcacattcactcagtgaaaacagcctccatcgggacgttaggaagg
agccggcctcctatgccagtggttgttccgagtgcccctgaagtacaggagaccaccagg
atgctggaagactccgagagtagctatgaaccagatgagctgaccaaagagatggcccac
ctggaaggactaatgaaggacctaaatgccatcacaacagcctga

DBGET integrated database retrieval system