Mus pahari (shrew mouse): 110328389 Help Entry 110328389         CDS       T05929                                  Name (RefSeq) glutathione S-transferase A2   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism mpah  Mus pahari (shrew mouse) Pathway mpah00480   Glutathione metabolism mpah00980   Metabolism of xenobiotics by cytochrome P450 mpah00982   Drug metabolism - cytochrome P450 mpah00983   Drug metabolism - other enzymes mpah01100   Metabolic pathways mpah01524   Platinum drug resistance mpah05200   Pathways in cancer mpah05204   Chemical carcinogenesis - DNA adducts mpah05207   Chemical carcinogenesis - receptor activation mpah05208   Chemical carcinogenesis - reactive oxygen species mpah05225   Hepatocellular carcinoma mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     110328389   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     110328389    00982 Drug metabolism - cytochrome P450     110328389    00983 Drug metabolism - other enzymes     110328389  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110328389    05204 Chemical carcinogenesis - DNA adducts     110328389    05207 Chemical carcinogenesis - receptor activation     110328389    05208 Chemical carcinogenesis - reactive oxygen species     110328389   09162 Cancer: specific types    05225 Hepatocellular carcinoma     110328389   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110328389   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110328389  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpah02000]     110328389 Enzymes [BR:mpah01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      110328389 Transporters [BR:mpah02000]  Other transporters   Pores ion channels [TC:1]    110328389 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  110328389 NCBI-ProteinID:  XP_021063477 Ensembl:  MGP_PahariEiJ_G0015329 LinkDB All DBs Position 10:complement(72929084..73030993) Genome browser AA seq 189 aa AA seqDB search MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLRKDGNLMFDQVPMVEI DGMKLVQTRAILNYIATKYDLYGKDVKERALIDMYSEGVLDLTEMIVQLIICPPDQKEAK TALAKDRAKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEELDASLLTPFPL LKAFKSNTY NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccgggaagcccgtgcttcactacttcaatgcccggggcaggatggagtgcatcagg tggctcctggccgcagcaggggtggagtttgaagagaagtttatacagagtccagaagat ctggaaaagctaagaaaagatgggaatttgatgtttgaccaagtgcccatggtggagatt gatgggatgaagctggtgcagaccagagccattctcaactacatcgccaccaaatatgac ctctatgggaaggacgtgaaggagagagccttgattgacatgtattcagaaggtgtttta gatctgactgaaatgattgtgcaattaataatatgtccaccagaccaaaaagaagccaag actgccttggcaaaagacagggccaaaaaccgttacttgcctgcctttgaaaaggtgttg aagagccatggacaagactaccttgtaggcaacaggctgaccagggtggacatccacctg ctggaacttctcctctatgttgaagagcttgatgccagccttctgacccctttccctctg ctgaaggccttcaagagcaacacttattga

DBGET integrated database retrieval system