KEGG   Mus pahari (shrew mouse): 110328516
Entry
110328516         CDS       T05929                                 

Gene name
Ctnnb1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04670  Leukocyte transendothelial migration
mpah04916  Melanogenesis
mpah04919  Thyroid hormone signaling pathway
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110328516 (Ctnnb1)
   04310 Wnt signaling pathway
    110328516 (Ctnnb1)
   04390 Hippo signaling pathway
    110328516 (Ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110328516 (Ctnnb1)
   04520 Adherens junction
    110328516 (Ctnnb1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110328516 (Ctnnb1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110328516 (Ctnnb1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110328516 (Ctnnb1)
   04916 Melanogenesis
    110328516 (Ctnnb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328516 (Ctnnb1)
   05205 Proteoglycans in cancer
    110328516 (Ctnnb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110328516 (Ctnnb1)
   05225 Hepatocellular carcinoma
    110328516 (Ctnnb1)
   05226 Gastric cancer
    110328516 (Ctnnb1)
   05216 Thyroid cancer
    110328516 (Ctnnb1)
   05217 Basal cell carcinoma
    110328516 (Ctnnb1)
   05215 Prostate cancer
    110328516 (Ctnnb1)
   05213 Endometrial cancer
    110328516 (Ctnnb1)
   05224 Breast cancer
    110328516 (Ctnnb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110328516 (Ctnnb1)
   05163 Human cytomegalovirus infection
    110328516 (Ctnnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110328516 (Ctnnb1)
   05165 Human papillomavirus infection
    110328516 (Ctnnb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110328516 (Ctnnb1)
   05100 Bacterial invasion of epithelial cells
    110328516 (Ctnnb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110328516 (Ctnnb1)
   05022 Pathways of neurodegeneration - multiple diseases
    110328516 (Ctnnb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110328516 (Ctnnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110328516 (Ctnnb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110328516 (Ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 110328516
NCBI-ProteinID: XP_021063580
Ensembl: MGP_PahariEiJ_G0015687
LinkDB
Position
10
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgacctgatggagttggacatggccatggagccggacagaaaggct
gctgtcagccactggcagcagcagtcttacttggattctggaatccattctggtgccacc
accacagctccttccctgagtggcaagggcaaccctgaggaagaagatgttgacacctcc
caagttctttatgaatgggagcaaggcttttcccagtccttcacgcaagagcaagtagct
gatattgacggtcagtatgcaatgactagggctcagagggtccgagctgccatgttccct
gagacactagatgagggcatgcagatcccatccacgcagtttgacgctgctcatcccact
aatgtccagcgcttggctgaaccatcacagatgttgaaacatgcagttgtcaatttgatt
aactatcaggatgacgcggaacttgccacacgtgcaattcctgagctgacaaaactgcta
aacgatgaggaccaggtggtagttaataaagctgctgttatggtccatcagctttccaaa
aaggaagcttccagacatgccatcatgcgctctcctcagatggtgtctgccattgtacgc
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggactctacacaac
ctttctcaccatcgagagggcttgctggccatctttaagtctggtggcatcccagcgctg
gtgaaaatgcttggatcaccagtggattctgtactgttctacgccatcacgacactgcat
aatctcctgctccatcaggaaggagctaaaatggcagtacgcctagctggtggactgcag
aaaatggttgctttgctcaacaaaacaaacgtgaaattcttggctattacaacagactgc
cttcagatcttagcttatggcaatcaagagagcaagctgatcattctggccagtggtgga
ccccaagccttagtaaacataatgaggacctacacttacgagaagcttctgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctctagcaacaagccggccattgtagaagct
ggtgggatgcaggcactggggcttcatctgacagacccaagtcagcgacttgttcaaaac
tgtctttggactctcagaaacctttcagatgcagcgactaagcaggaagggatggaaggc
ctccttgggactctagtgcagcttctgggttccgatgatataaatgtggtcacctgtgca
gctggaattctctctaacctcacttgcaataattacaaaaacaagatgatggtgtgccaa
gtgggtggcatagaggctcttgtacgcactgtccttcgtgccggtgacagggaggacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccggcatcaggaagccgagatg
gcccagaatgctgttcgtcttcattatggactgcctgttgtggttaaactcctgcaccca
ccatcccactggcctctgataaaggcaactgttggattgattcgaaaccttgccctttgc
ccagcaaatcatgctcctttgcgggaacagggtgctattccacgattagttcagctgctt
gtacgagcacatcaggacacccaacggcgcacctccatgggtggaacacagcagcagttt
gtggagggtgtgcgaatggaggagatagttgaagggtgtactggagcgctccacatcctc
gctcgggatgttcacaaccggattgtaatccgaggactcaataccattccattgtttgtg
cagttgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgctgaggccatagaagctgagggagccacagctcccctg
acagagttactccactccaggaatgaaggcgtggcgacatatgcagctgctgtcctattc
cgaatgtctgaggacaagccacaggattacaaaaagcggctttcagtcgagctaaccagt
tccctcttcaggacagagccaatggcttggaatgagactgctgatcttggactggacatt
ggtgcccagggagaagcccttggatatcgccaggatgatcccagctaccgatcttttcac
tctggtggatacggccaggatgccttggggatggaccctatgatggagcatgagatgggc
ggccaccaccctggtgctgactatccagttgatgggctgcctgatctggggcacgcccag
gacctcatggatgggctgcccccaggtgatagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system