KEGG   Mus pahari (shrew mouse): 110329108
Entry
110329108         CDS       T05929                                 
Symbol
Ocln
Name
(RefSeq) occludin
  KO
K06088  occludin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329108 (Ocln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329108 (Ocln)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110329108 (Ocln)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110329108 (Ocln)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110329108 (Ocln)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110329108 (Ocln)
SSDB
Motif
Pfam: MARVEL Occludin_ELL HBM APG6_N GAS Laminin_II DUF4164 TMF_TATA_bd Swi5 FapA Anthrone_oxy DivIC
Other DBs
NCBI-GeneID: 110329108
NCBI-ProteinID: XP_021064337
Ensembl: MGP_PahariEiJ_G0015914
LinkDB
Position
11:complement(31378262..31434184)
AA seq 522 aa
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNYPYGSGFGYGGGYGGYG
YGYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLTVIIVSAI
LGIMVFIATIVYIMGVNPTAQASGSMYGSQIYTICNQFYTPGGTGLYVDQYLYHYCVVDP
QEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNV
SAGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFYKSTPLVPEVAQEIPLTSSV
DDFSQPRYSSHGNLETPSKRAPTKGKAGKGKRTDPDHYETDYTTGGESCEELEEDWVREY
PPITSDQQRQLYKRNFDAGLQEYKSLQAELDEVNKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKRNYCKELKSKLSHIKRMVGDYDRRKT
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtccgtgaggccttttgaaagtccacctccttacagacctgatgaattcaaacccaat
cattatgcgccaagcaatgatatgtatggcggagagatgcacgtcagaccgatgctctct
cagccggcgtactctttttatccggaagatgaaattcttcacttctacaaatggacgtcg
cccccgggggtgattcggatcctgtctatgctcattattgtgatgtgcatcgccatattt
gcctgtgtggcttccacacttgcttgggacagaggctacgggacaggcctctttggagga
agcctaaactacccttatggaagcggctttggctacggaggtggctatggaggctacggc
tatggctatggctatgggtatggcgggtatacagatccaagagcagccaaaggcttcctg
ttggccatggcagccttctgcttcatcgcttccttggtaatatttgtgaccagtgttata
agatctggaatgtccaggacgagaaggtattacttgactgtgatcatagtcagcgccatc
ctgggcatcatggtgtttattgccacgattgtgtacataatgggagtgaacccgacggcc
caggcttctggatctatgtacggctcacagatatataccatctgcaaccagttttatact
ccgggaggcactggtctctacgtggatcaatatttgtatcactactgtgtggtggatccc
caggaggctatagctattgtcctggggttcatgattatcgtggcttttgctttaatcatc
ttttttgctgtgaaaacccgaagaaagatggaccggtatgataagtccaatattttgtgg
gataaggaacacatttatgatgaacagccccccaatgttgaagagtgggttaaaaatgtg
tctgcaggcacacaggacatgcctccacccccatctgactatgcagaaagagttgacagt
ccgatggcctactcctccaatggcaaagtgaatggcaagcgatcatacccagagtctttc
tataagtcaacgcctctggtgcctgaagtggcccaggagattcctctgacctcgtctgtg
gacgacttcagccagcctcggtacagcagccatggtaacttagagacgccttctaaaagg
gctcccacgaaggggaaagcaggaaagggcaagaggacggaccccgaccactatgaaaca
gactacacgacgggcggggagtcctgcgaggagctggaggaggactgggtcagggaatat
ccacctatcacttcagatcaacaaagacaactctacaagagaaatttcgatgcaggtcta
caggagtataagagtttacaggcagaactggacgaggtcaataaagagctctctcgtcta
gataaagagctggatgactacagggaggagagcgaagagtacatggctgctgctgatgaa
tataatagactaaagcaagttaaaggatctgcagattataaaagtaagaggaattactgc
aaggagttgaagagcaaattatcgcacatcaagaggatggtgggagactatgacagacgg
aaaacttag

DBGET integrated database retrieval system