KEGG   Mus pahari (shrew mouse): 110329614
Entry
110329614         CDS       T05929                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04012  ErbB signaling pathway
mpah04062  Chemokine signaling pathway
mpah04110  Cell cycle
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04657  IL-17 signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04728  Dopaminergic synapse
mpah04910  Insulin signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05135  Yersinia infection
mpah05160  Hepatitis C
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05415  Diabetic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110329614 (Gsk3b)
   04310 Wnt signaling pathway
    110329614 (Gsk3b)
   04340 Hedgehog signaling pathway
    110329614 (Gsk3b)
   04390 Hippo signaling pathway
    110329614 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    110329614 (Gsk3b)
   04150 mTOR signaling pathway
    110329614 (Gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110329614 (Gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110329614 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    110329614 (Gsk3b)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110329614 (Gsk3b)
   04657 IL-17 signaling pathway
    110329614 (Gsk3b)
   04662 B cell receptor signaling pathway
    110329614 (Gsk3b)
   04062 Chemokine signaling pathway
    110329614 (Gsk3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110329614 (Gsk3b)
   04917 Prolactin signaling pathway
    110329614 (Gsk3b)
   04935 Growth hormone synthesis, secretion and action
    110329614 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    110329614 (Gsk3b)
   04916 Melanogenesis
    110329614 (Gsk3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110329614 (Gsk3b)
   04722 Neurotrophin signaling pathway
    110329614 (Gsk3b)
  09158 Development and regeneration
   04360 Axon guidance
    110329614 (Gsk3b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329614 (Gsk3b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110329614 (Gsk3b)
   05225 Hepatocellular carcinoma
    110329614 (Gsk3b)
   05226 Gastric cancer
    110329614 (Gsk3b)
   05217 Basal cell carcinoma
    110329614 (Gsk3b)
   05215 Prostate cancer
    110329614 (Gsk3b)
   05213 Endometrial cancer
    110329614 (Gsk3b)
   05224 Breast cancer
    110329614 (Gsk3b)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110329614 (Gsk3b)
   05162 Measles
    110329614 (Gsk3b)
   05163 Human cytomegalovirus infection
    110329614 (Gsk3b)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110329614 (Gsk3b)
   05165 Human papillomavirus infection
    110329614 (Gsk3b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110329614 (Gsk3b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110329614 (Gsk3b)
   05020 Prion disease
    110329614 (Gsk3b)
   05022 Pathways of neurodegeneration - multiple diseases
    110329614 (Gsk3b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110329614 (Gsk3b)
   05415 Diabetic cardiomyopathy
    110329614 (Gsk3b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110329614 (Gsk3b)
   04931 Insulin resistance
    110329614 (Gsk3b)
   04934 Cushing syndrome
    110329614 (Gsk3b)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110329614 (Gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110329614 (Gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110329614 (Gsk3b)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     110329614 (Gsk3b)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   110329614 (Gsk3b)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110329614 (Gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 110329614
NCBI-ProteinID: XP_021065014
Ensembl: MGP_PahariEiJ_G0016436
LinkDB
Position
12
AA seq 433 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTPGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcggagagctgcaagccagtgccgcagcct
tcagcttttggtagcatgaaagttagcagagataaagatggcagcaaggtaaccacagtg
gtggcaactcctggacagggtcctgacaggcctcaggaagtcagttatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattccggagaa
ctggttgccatcaagaaagttctgcaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtccgactgcggtatttcttctactcgagtggc
gagaagaaagatgaggtctaccttaacctggtgctggactatgttccggagacagtgtac
agagttgccagacactatagtcgagccaagcagacactccctgtgatctatgtcaagttg
tatatgtatcagctgttcagaagtctagcctatatccattcctttggaatctgccatcga
gacattaaaccacagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaaacagctggtccgaggagagcccaatgtttcatatatctgttctcgg
tactaccgggcaccagagttgatctttggagccactgattacacatccagtatagatgta
tggtctgcaggctgtgtgttggctgaattgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataataaaggtcctaggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaattcccccaaatcaaggcacatcct
tggacaaaggactcatcaggaacaggacatttcaccccaggagtacgggtcttccggccc
cgaactccaccagaggcaattgcactgtgcagccgtctgctggagtacacaccaaccgcc
cggctaacaccactggaagcttgtgcacattcatttttcgatgaattgcgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaactttaccactcaagaactg
tcaagtaacccccctctggccaccatccttatccctcctcatgctcggattcaagcagct
gcttcaccgcctgccaacgccacagcagcctcagatactaatgctggagaccgtggacag
accaataacgccgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system